KEGG   Caenorhabditis elegans (nematode): CELE_T21D11.1
Entry
CELE_T21D11.1     CDS       T00019                                 

Gene name
zmp-6
Definition
(RefSeq) ZnMc domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
Motif
Pfam: Peptidase_M10 Reprolysin_3 Reprolysin_4 DUF4953 Reprolysin_5 Peptidase_M54
Other DBs
NCBI-GeneID: 176025
NCBI-ProteinID: NP_498599
WormBase: WBGene00020646
Ensembl: WBGene00020646
UniProt: G5ECC4
Position
III:complement(join(7245809..7245927,7246368..7246508,7246582..7246791,7247251..7247405,7247456..7247543,7247642..7247768))
AA seq 279 aa
MRSILLFILIFLIFAISEAQENIDKNLDFIKPIGFGSREKRYVIRAKRWKKHTLTWQLQT
QNLLDPDVFIVRNTMHRAFNEWSTVSSVDFREIPPDLVTKQPPDIYIAFEKGEHSDGFPF
DGQDGVVAHAFYPRDGRLHFDAEEQWSLNSVEGVNLFQTAVHEIGHLLGLEHSMDVRAAM
FAAKRPYDPAFTLGDDDVRAIRSLFPINETDANSGSEENSEDPVTTVKPISKEEGIDEEN
NDPFDASSTTTSSSSPDSFFPFPLPSIEHFQRRNDWFVL
NT seq 840 nt   +upstreamnt  +downstreamnt
atgcgttctatattactttttattcttatattcttgatttttgcaattagtgaagctcaa
gagaatattgataaaaacctcgatttcataaaaccgattggtttcgggagcagggagaaa
agatacgtgattcgagcaaaacgatggaaaaagcacacattaacgtggcagttacagact
cagaatttattagatccagatgtttttattgtaagaaatacaatgcaccgagcattcaac
gaatggtcaaccgtatcatccgttgattttcgagaaataccacccgatttggtaacaaag
caaccacctgatatctacattgcattcgaaaaaggagaacattccgatggattcccattt
gatgggcaagacggagtagtagctcatgcattctatccacgtgatggacgactacacttt
gacgccgaagaacaatggagccttaattcagttgaaggcgtcaatttattccagacagca
gtacatgaaattggtcatctgttaggtttggagcattcaatggatgttcgagcagcaatg
tttgctgctaaaagaccttatgatcctgcattcactttaggtgatgacgatgtacgagcc
attagatctttattccctataaatgaaacagatgcaaattctggaagcgaagagaattca
gaggatccggtgacaactgttaagccaatcagcaaagaagaaggaattgacgaagaaaat
aacgatccatttgatgcatcttcaacaaccacatcttcatcatctcctgactcttttttc
ccatttccacttccttcaattgagcattttcaaagacgaaacgactggtttgttctatag

DBGET integrated database retrieval system