KEGG   Caenorhabditis elegans (nematode): CELE_T23D8.1
Entry
CELE_T23D8.1      CDS       T00019                                 

Gene name
mom-5
Definition
(RefSeq) Protein mom-5
  KO
K02432  frizzled 1/7
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04150  mTOR signaling pathway
cel04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CELE_T23D8.1 (mom-5)
   04150 mTOR signaling pathway
    CELE_T23D8.1 (mom-5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cel04030]
    CELE_T23D8.1 (mom-5)
G protein-coupled receptors [BR:cel04030]
 Frizzled / Smoothened family
  CELE_T23D8.1 (mom-5)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR LapA_dom
Other DBs
NCBI-GeneID: 172856
NCBI-ProteinID: NP_001300437
WormBase: WBGene00003397
Ensembl: WBGene00003397
UniProt: A0A0K3AWM6
Position
I:join(9965641..9966113,9966607..9966977,9967042..9967180,9967721..9967962,9968075..9968195,9968543..9968761,9969187..9969334)
AA seq 570 aa
MHRHILILFLFGCLSADQRLSSTSISSMNGFSTTRKCEHITIPMCKNLDYNQTVFPNLLG
HTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVCTVLEKPIQPCRELCLSAKNGCE
SLMKKFGFQWPDQLDCNKFPVTDLCVGKNSSESSNSKNYRSSNDVTFGVSTIANEVVLSP
KKCPHHMHTTSGSHFSLPLLSGRLPECSLTCEADNQVPMMFDGRVRRILRIWTAAWSVAC
FVCSLFTLVTFLVDLSRFAYPVRPILYLAFCYLAISTVYMIGVVGEDGFACGTYGSTPTT
LVTQGGENVGCSALAVVHYFFFMSSCAWWLVLCLAWFLAANLKWGAESIAALSPYFHAMC
WGVPAVLSVTVLVTNSVDGDVFTGICSVGNLNPSALVYFFFTPIVVSLALGAVLLVCGIW
SMIRIRSYIKLQHADVERNISKLEKLMLRIGAFAIMYSLPTAMNAAIMWYQAVNMPAWLE
GWLHHRCVRLQDRELFGFTYPVDDCPMDPKVAAPEIIVFLLKYVSQLVVGITCAIWVVSS
KTLSSYHKAYLALSSRSPTVPAHVDQVNMR
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgcatcgacatattctgatattatttttattcggatgcttatcagctgatcaacgactc
tcatcaacttcaatttcatcgatgaatggattctcaacaactcgaaaatgtgaacatatt
acaattccaatgtgcaaaaatctggattacaatcaaacagtatttccaaatcttctcgga
catacaacacaatctgaagctggtccagcaattgcgcaattcaatccattaattaaagtt
aaatgctcagaagatattcgtctctttctttgtactgtctatgcacctgtctgtacagta
ctcgaaaaaccaattcaaccatgtcgagaattgtgtttatctgcaaaaaatggatgcgag
tcattaatgaaaaagtttggatttcaatggccagatcaattggattgtaacaaattccca
gtaactgatttgtgtgttggcaagaattccagcgagtcgagcaactctaaaaattacaga
agtagtaatgacgtcacattcggtgtttcaacaattgccaacgaagttgtcctttctcca
aaaaaatgccctcatcatatgcatacaacaagcggatctcatttttcattgcctcttctc
agtggacgccttcctgaatgttcattaacatgtgaagctgacaatcaagtaccaatgatg
tttgatggacgtgttcgacgaattcttcgaatctggacagcagcatggtctgtggcatgt
ttcgtgtgctctttattcactcttgtcacatttcttgttgatttatcacgattcgcgtat
ccagttcgaccgattttgtatctcgcgttctgttatctagcaatttctacggtttatatg
ataggcgtagtcggtgaagatggattcgcttgtggaacgtatggatctactccaacaaca
cttgttacgcaaggaggagaaaatgttggatgtagtgctcttgctgttgttcattacttt
ttcttcatgtcaagttgtgcgtggtggcttgtactgtgtctagcctggttcctggcggca
aatctgaaatggggagctgaatcaattgctgctctgtcaccatacttccacgcaatgtgc
tggggagttccagcagttctctcggttactgtactagtgacaaattctgtcgatggagat
gtatttactggaatctgttcagttggaaatttgaatccctctgctctcgtctatttcttt
ttcactccgatcgttgtatcgttggcactcggagcagttttactcgtttgtggaatttgg
tcaatgatccgtattcgaagttatattaaacttcaacacgccgatgttgagaggaatatc
agtaaattggagaaattaatgttgagaatcggtgccttcgccataatgtactctctacca
actgcaatgaatgctgcaattatgtggtatcaggcagtaaatatgcctgcctggcttgaa
ggatggcttcatcatcgatgtgttcgacttcaagatcgagaattattcggtttcacgtat
ccagttgatgattgtccgatggatccgaaagttgcagctccggagattattgtttttctt
ttaaaatatgtgtctcaattggttgttggtataacctgtgccatttgggttgtctcttca
aaaactctttcaagttatcacaaggcttacctggcactctcttcgaggtcacctactgta
cctgctcatgttgatcaggttaatatgaggtga

DBGET integrated database retrieval system