KEGG   Caenorhabditis elegans (nematode): CELE_T23G11.2
Entry
CELE_T23G11.2     CDS       T00019                                 

Symbol
gna-2
Name
(RefSeq) Glucosamine 6-phosphate N-acetyltransferase
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 C4bp_oligo Rubredoxin_C AstA
Other DBs
NCBI-GeneID: 172533
NCBI-ProteinID: NP_492144
WormBase: WBGene00001647
Ensembl: WBGene00001647
UniProt: G5EC27
Position
I:join(7699686..7699906,7699954..7700116,7700167..7700531,7700580..7700874)
AA seq 347 aa
MSSISIFDEILLPTDISVPTGLRLRALRNDDFGYLELLKQLTSVGFINQLVFRKQFDAMK
KAKSYYIVVLEHIESSKIIGAATLLIEFKYIHEAGTRGRVEDVVVDEKMRGKKLGALLNE
VLVEMAKTIGVYKLSLECKTELIPFYNKFGYSKNLHFLDQRFEELEAPARKSSTPGNGSV
ILFNENVLPTNMKLPVDIRARALRSDDMNYLKLLEQLTSVGYVTKNDFEQRFSTMKNSES
YFIVVLEDVNSSKIVGAATLVVELKYIHECGLRGRVEDVVVDLTMRGKRLGILINEALVK
MARSLGVYKLSLECKTELIPFYNKFGYNENIHFMVQRFDKPEIITLD
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgtcatcgatttcaattttcgatgaaatccttctcccaacagatatttctgttcctact
ggtctccgtcttcgtgctcttcgaaatgatgattttggatatctcgaattgctgaaacag
ctcacttctgttgggttcatcaatcaattggtgtttcgaaaacaatttgatgctatgaaa
aaggctaaatcgtattacattgttgttctcgaacacattgaatcttctaaaattattggc
gccgcaacattgctcatagaatttaagtacattcacgaagcgggaacacgtggcagagtt
gaagatgtggttgttgacgagaaaatgcgtggaaagaagctaggagcgcttctcaacgaa
gttcttgtcgaaatggcgaagacgattggcgtctacaagttgtcacttgagtgcaaaact
gaattgatcccattttataacaaatttggctattcaaagaatcttcactttttggatcaa
cgttttgaagaactggaagctcccgctcggaaatcgtctacacctggaaatggatcagtt
atccttttcaatgagaacgttcttccgacaaatatgaaacttcctgtcgatatccgtgct
cgcgctctccgttccgatgacatgaattatctgaaacttctggagcaactcacttccgtt
ggatacgtcacgaaaaatgactttgagcaaagattttctacaatgaaaaattcagagtcg
tatttcatagtagttttagaagatgtaaattcttcaaaaattgttggtgctgccactctt
gtagtcgagctcaagtacattcatgaatgtggacttcgtggaagagtcgaagatgttgtc
gttgatttgacaatgcgtggaaaaaggctgggaattcttatcaacgaagctctcgttaaa
atggcaagaagtcttggagtttataaactttctctggaatgcaaaacagagcttatccca
ttctacaacaaattcgggtacaacgagaacatccatttcatggttcaacgcttcgacaag
ccagaaattatcactttggactaa

DBGET integrated database retrieval system