KEGG   Caenorhabditis elegans (nematode): CELE_W08E3.1
Entry
CELE_W08E3.1      CDS       T00019                                 

Gene name
snr-2
Definition
(RefSeq) Probable small nuclear ribonucleoprotein-associated protein B
  KO
K11086  small nuclear ribonucleoprotein B and B'
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CELE_W08E3.1 (snr-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cel03041]
    CELE_W08E3.1 (snr-2)
   03032 DNA replication proteins [BR:cel03032]
    CELE_W08E3.1 (snr-2)
Spliceosome [BR:cel03041]
 Complex A
  U1 snRNP components
   Sm proteins
    CELE_W08E3.1 (snr-2)
  U2 snRNP components
    CELE_W08E3.1 (snr-2)
 Complex B
  U1 snRNP components
    CELE_W08E3.1 (snr-2)
  U4/U6.U5 tri-snRNP components
    CELE_W08E3.1 (snr-2)
 Complex C
  U2 snRNP components
    CELE_W08E3.1 (snr-2)
DNA replication proteins [BR:cel03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     CELE_W08E3.1 (snr-2)
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 173204
NCBI-ProteinID: NP_493348
WormBase: WBGene00004915
Ensembl: WBGene00004915
UniProt: P91918
Position
I:join(13339431..13339433,13339487..13339657,13339714..13340022)
AA seq 160 aa
MTISKNNKMMAHLNYRMKIILQDGRTFIGFFKAFDKHMNILLAECEEHRQIKPKAGKKTD
GEEKRILGLVLVRGEHIVSMTVDGPPPRDDDSVRLAKAGGAGGVGQAKPGGRGMPAMPGM
PGMPPGGAPGGLSGAMRGHGGPGMAAMQPGYGGPPGGRPF
NT seq 483 nt   +upstreamnt  +downstreamnt
atgactatctccaagaataataagatgatggctcatctcaactacaggatgaagatcatc
cttcaggacggtagaaccttcatcggatttttcaaggctttcgacaagcatatgaacatt
ttactcgcagagtgcgaggaacacagacaaatcaagccaaaggccggaaagaagaccgat
ggagaagaaaagcgaattctcggcctcgtactggtccgcggagaacatatcgtctcgatg
accgtcgacggaccaccaccaagagatgacgattcagtgagactcgccaaggccggagga
gctggaggtgtcggacaagccaagccaggaggccgtggaatgccagctatgccaggaatg
ccgggaatgccaccaggcggagcaccaggaggcctctctggagccatgcgcggacacgga
ggaccaggaatggcagccatgcagccaggatatggcggcccaccaggaggacgtccattc
taa

DBGET integrated database retrieval system