KEGG   Caenorhabditis elegans (nematode): CELE_Y43F8A.3
Entry
CELE_Y43F8A.3     CDS       T00019                                 

Gene name
nceh-1
Definition
(RefSeq) Neutral Cholesterol Ester Hydrolase homolog
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Abhydrolase_3 COesterase Say1_Mug180 Abhydrolase_6 Peptidase_S9 Hydrolase_4 Abhydrolase_1 PGAP1 Thioesterase LIDHydrolase LrgB SGNH Chlorophyllase2 Eno-Rase_NADH_b IceA2 DUF2974 Esterase_PHB
Other DBs
NCBI-GeneID: 189866
NCBI-ProteinID: NP_001256852
WormBase: WBGene00012810
Ensembl: WBGene00012810
UniProt: Q9XWL5
Position
V:join(19377450..19377626,19378314..19378585,19379280..19379605,19379746..19379873,19380563..19380802,19380849..19380980)
AA seq 424 aa
MTQPLSKFGSITFATILLAFSILLVLHKPLPPGLCEKSTVDRVVIHLFEPILRAFYYYPA
NYIFTTPANQIWWTRYSLGLLAKTMGPVTLFERHLVRVTDATWNGVHVRTYEPRLVENST
DGAVIFIHGGGFAIGSVAMYDSLTRRMAKSMNTFVVSIDYRLSPETVFPENLLDCEKAID
YFLENSLEKFKIDPKKVILVGDSAGGNLATAIAQRRAEKGAEPKLLAQVLLYPLLQLVDL
QMTSYRYFHKRLTGIAFVDPASVAFYYMLYAGIPLEKAKELVPIVLTNGHVKPDYREKID
KLLTYRTTIESTHTYNTTKIPKRWEIVENSEAQNLLEKVIFDPNFSPIMRENLENLPKSL
IVTCEYDVLRDEGLIYSERLMASGVPTKLINYKNGYHAMLNMHNEITEASTCLDDVMHWI
LEQF
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgacacaaccattatccaaatttggttctatcacgtttgccacaattctcctggccttc
tccatacttctagtgctccataagccacttccgcctgggctctgtgagaaatcaacagtc
gatcgagtggttattcatctttttgagcccatacttcgtgcattttattattatccggcc
aactacattttcacgactccagctaaccaaatctggtggacccgttactctttaggcctt
ctggccaagactatgggcccagtaaccctatttgaacggcacctggtacgtgtgacggat
gccacgtggaatggggtccacgtgaggacttatgagccacggctcgtggagaactcgacg
gatggagccgtgatctttattcatggcgggggatttgcgattggaagtgttgccatgtat
gatagcttgacaaggagaatggcaaaatccatgaacacatttgtagtatctattgactac
cgattgtccccggaaactgtgtttcctgagaatctactggactgcgaaaaagccatcgac
tatttcctcgaaaactccctcgaaaagttcaaaatcgatccgaaaaaggtgatacttgtc
ggagattctgctggcggaaatttggcaactgcaattgctcagcgaagagctgaaaaaggg
gcggagccaaagcttttggctcaggtgctgctgtaccccctgttgcagctggtagatttg
caaatgacgtcataccggtattttcataaaaggctgactggaattgcgtttgtagacccc
gcctcagttgcattttactacatgctgtatgctggtattcccctggaaaaagctaaggaa
ctagtgcctatagtgctgacaaatgggcatgtgaagccggattacagagagaaaatcgat
aagcttctcacctaccgtaccaccatcgaatccacccacacctacaacacaacgaaaatc
ccaaaaagatgggaaatcgtagaaaactcggaagcccaaaatttgctagaaaaagttatt
ttcgacccgaatttctcgccgataatgcgggaaaatctagaaaatttgccgaaaagtttg
attgtcacctgtgaatacgatgtgctcagggacgagggcttgatctactccgagaggctt
atggcttctggagtgcctacaaagcttataaactacaaaaatgggtaccatgcaatgctc
aatatgcacaatgagattaccgaggcttccacgtgtctcgatgacgtcatgcactggatt
ttggagcaattttaa

DBGET integrated database retrieval system