KEGG   Caenorhabditis elegans (nematode): CELE_Y49F6B.10Help
Entry
CELE_Y49F6B.10    CDS       T00019                                 

Gene name
col-71
Definition
(RefSeq) COLlagen
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen Col_cuticle_N
Motif
Other DBs
NCBI-GeneID: 173695
NCBI-ProteinID: NP_494562
WormBase: WBGene00000647
Ensembl: WBGene00000647
UniProt: Q9N4U2
Position
II:complement(join(3500147..3500805,3501565..3501925,3502349..3502444))
Genome map
AA seq 371 aa AA seqDB search
MRNAGGDKPFSTPVLLREMGLKTHVDDDPKTKAYRLIGYAAVTFSTVSVICFCVTMPVVF
TYVQSVKRQMSHEMATCNVNARQIFDDVAALRAGFPFAQAGNRTARQAGYDVHPSKPTPV
GYSGGDAAAAEVKGNSPAAAYEDKPFVAVGVEEGPHTATTGSDSEGTCHDCCLPGPPGPP
GPPGRPGPNGKAGANGLNGNPGRPPEAPCEPVTPPPCPPCPAGPKGAPGQAGYPGADGQP
GSQGDNGEKGSDGAAGEKGRPGPLGKIGEPGATGETGENAENSEPTPGPQGPPGAIGPVG
SRGTPGHPGEDGEAGAPGAPGENGTDGENGEDGVPGVPGHDGKAGRAGERGICPKYCAKD
GGIFFEDGTRR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacgcaggcggtgataagccattctccacacccgttttgcttcgcgaaatgggc
ttgaagacgcacgttgatgatgatccgaagactaaggcctaccgccttatcggctacgcc
gccgtcaccttctccacagtctcggtgatctgtttctgtgtcacaatgccagttgtcttc
acctacgtccaatcggtaaaacgtcagatgtcccatgagatggccacgtgcaacgtcaat
gctcgtcagattttcgatgacgttgctgctctgcgagccggcttcccattcgcacaggca
ggcaaccgtaccgcccgtcaagctggatacgatgtgcatccgagcaagccaacgcctgtc
ggatatagtggtggagatgcggctgcggcggaggtgaagggaaatagcccggcggccgcc
tacgaggataagccgtttgttgctgttggagttgaagaaggaccacacaccgccaccacg
ggctctgactccgaaggaacgtgccacgactgctgccttccaggcccaccaggcccacca
ggacctccaggccgtccaggaccaaacggaaaggccggcgccaacggactcaacggaaac
ccaggaagaccaccagaggctccatgtgagccagtaaccccaccaccatgcccaccatgc
ccagcaggaccaaagggagcccctggacaagccgggtacccgggagccgacgggcaacct
ggatcgcagggagacaatggagagaagggatcagacggtgctgctggagagaaaggacgt
ccaggaccacttggaaagatcggagagccgggagcaactggagagacgggagagaacgct
gagaatagtgagccgactccaggaccacaaggaccaccgggagccattggaccagttgga
tcacgtggaactccaggacatcctggagaagatggagaagctggagctccgggagcacct
ggagagaatggaactgacggagagaatggagaagatggagttcctggagttccaggacac
gatggaaaagccggaagagctggagaacggggaatttgtccaaagtattgcgccaaggat
ggaggaatcttctttgaggatggaacccggcgttag

DBGET integrated database retrieval system