KEGG   Caenorhabditis elegans (nematode): CELE_Y53C10A.12
Entry
CELE_Y53C10A.12   CDS       T00019                                 

Symbol
hsf-1
Name
(RefSeq) HSF_DOMAIN domain-containing protein
  KO
K09414  heat shock transcription factor 1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04212  Longevity regulating pathway - worm
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_Y53C10A.12 (hsf-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cel03000]
    CELE_Y53C10A.12 (hsf-1)
Transcription factors [BR:cel03000]
 Eukaryotic type
  Helix-turn-helix
   Heat shock factors
    CELE_Y53C10A.12 (hsf-1)
SSDB
Motif
Pfam: HSF_DNA-bind UPF0242
Other DBs
NCBI-GeneID: 173078
NCBI-ProteinID: NP_493031
WormBase: WBGene00002004
Ensembl: WBGene00002004
UniProt: G5EFT5
Position
I:complement(join(11953797..11953889,11955323..11955805,11956675..11957263,11958236..11958370,11958767..11958900,11959111..11959244,11959917..11960136,11961735..11961962))
AA seq 671 aa
MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS
SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI
SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF
VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE
NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP
NSKRARMNSEEGPYKDVCDLLESLQRETQEPFSRRFTNNEGPLISEVTDEFGNSPVGRGS
AQDLFGDTFGAQSSRYSDGGATSSREQSPHPIISQPQSNSAGAHGANEQKPDDMYMGSGP
LTHENIHRGISALKRDYQGASPASGGPSTSSSAPSGAGAGARMAQKRAAPYKNATRQMAQ
PQQDYSGGFVNNYSGFMPSDPSMIPYQPSHQYLQPHQKLMAIEDQHHPTTSTSSTNADPH
QNLYSPTLGLSPSFDRQLSQELQEYFTGTDTSLESFRDLVSNHNWDDFGNNVPLDDDEEG
SEDPLRQLALENAPETSNYDGAEDLLFDNEQQYPENGFDVPDPNYLPLADEEIFPHSPAL
RTPSPSDPNLV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgcagccaacagggaatcaaatacaacaaaaccagcaacaacagcaacaactgataatg
cgtgttccgaaacaagaagtttcagtttctggagcagcacgtcgttatgttcaacaggct
ccaccgaatcgaccaccacggcagaatcatcaaaatggggcaattggtggcaaaaagtca
tcggttactatacaagaagttccgaataatgcgtatttggagaccttgaacaaatccgga
aacaacaaagttgacgacgacaagcttccagtatttctgataaaattgtggaatatcgta
gaagatccaaatcttcaatcaattgttcattgggatgattctggtgcaagctttcatatt
tctgatccatatttatttgggagaaatgttttgccgcattttttcaagcataacaatatg
aatagcatggtcagacagttgaatatgtacggcttccgaaagatgactccactgtcccaa
ggtggtctaactcgaacagaatcagatcaggatcatttagagtttagtcatccgtgtttt
gtacaaggacgtcccgaattactatcacagattaagagaaagcaatcggcaagaactgtg
gaggacaagcaggttaacgaacagacgcaacaaaatttggaagtagtaatggcagagatg
cgtgcgatgcgagaaaaggcaaagaatatggaggataagatgaataagcttacaaaagaa
aatcgcgatatgtggacacaaatgggctcaatgcgtcaacaacatgctcgccaacagcaa
tatttcaaaaaacttttgcattttctcgtctctgtcatgcagccaggattgtcgaagcgt
gtcgcgaaacgaggtgtgctggaaatagacttttgcgccgccaacggaactgccggaccc
aactcaaaacgtgctcgaatgaactctgaagaaggtccatacaaggatgtttgtgatcta
ctagaatcacttcaacgcgagactcaggaaccattttcccgtcgatttacgaataatgaa
ggaccactgatctcagaggttaccgatgaatttggaaattctcctgttggaagaggaagt
gctcaggatctatttggtgatacatttggagcacaaagtagtcgatattctgatggagga
gctacaagctcacgtgaacaatctccacatcctataatatctcagccgcagagcaactcg
gctggagcacacggagccaatgagcaaaagccagatgatatgtacatgggatccggtcca
ttgactcatgagaatattcatcgtgggatttctgcgctgaaacgggattatcagggtgct
tctcctgcttcaggaggaccatctacatcatcttcggctccatctggagctggagctgga
gcaagaatggctcaaaaacgagcggctccgtataagaatgcgactaggcaaatggctcag
ccgcaacaagactattcgggaggatttgtgaacaattacagtggcttcatgccttcagat
ccttcaatgattccatatcaaccatctcatcaataccttcaaccacatcagaagctaatg
gcaatagaagatcagcatcatccaacgacttccacctcatccaccaacgcagatcctcat
caaaatctatattctccaactctcggactctctccatcatttgatcgtcaattatctcaa
gaacttcaagaatatttcactggaactgatacttcattggagagtttcagagatttagtc
agtaatcataattgggatgattttgggaataatgtaccgttggatgatgatgaagaagga
tccgaggatccactcagacagcttgctcttgaaaatgctccggagacgtcgaattatgat
ggagccgaggatttgttgtttgataatgagcaacagtacccggaaaatggatttgatgtg
ccggacccaaactacttgccacttgccgacgaggaaatcttcccacattcaccggctctt
cgtactccaagtccatcggatcctaatttggtttaa

DBGET integrated database retrieval system