KEGG   Caenorhabditis elegans (nematode): CELE_ZC101.2
Entry
CELE_ZC101.2      CDS       T00019                                 

Gene name
unc-52
Definition
(RefSeq) Basement membrane proteoglycan
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig Ldl_recept_a Laminin_B Laminin_G_2 Laminin_G_1 V-set Ig_6 Laminin_EGF Laminin_G_3 TFIIA SEA
Other DBs
NCBI-GeneID: 175126
NCBI-ProteinID: NP_001364664
WormBase: WBGene00006787
Ensembl: WBGene00006787
Position
II:complement(join(14647479..14647857,14647920..14648142,14648552..14648827,14648886..14649435,14649495..14649607,14649651..14649798,14649844..14650013,14650061..14650279,14650326..14650538,14650594..14650898,14651003..14651210,14652683..14652809,14653661..14653815,14654219..14654458,14654571..14654777,14656090..14656270,14656328..14657097,14657213..14657491,14657638..14657919,14658038..14658334,14658475..14658753,14658804..14659367,14659535..14659813,14661744..14661937,14662038..14662649,14662697..14662785,14662833..14663105,14663345..14664211,14664402..14664413,14664632..14664977,14665646..14665976,14666057..14666329,14666388..14666693,14675475..14675635,14675916..14676417,14676526..14676972,14677659..14677787,14681143..14681323,14681693..14681802,14682191..14682341,14682707..14682889,14683066..14683304,14683391..14683545,14684094..14684296))
AA seq 4075 aa
MAFSLFSVVSLTVIYRLTINFPELPYTQELKNVESDEFVSTSRDIAHSIQELVKDLEGRH
TAKVADYKYHKIIGSLVYVDLYAEKESPLVSDVLLSAIKSGKIGNLTVSDEGFELHVVRD
SSIACATTEFTCLDKSCIPADQRCDGRRNCPDGSDEHKEHGKCKQHQPIIHQTEKVVFAQ
KHGSIHLSASIDSSVEDNKIAWSKDSVLLGVGSMTLAEDGRVTVYKKGDKHHLHIINATD
ADDGTYKMIVQGINVEADFEVRITSDRVATESDECPSGERACKSGHCLPVAQFCDRRVQC
PDGDDEEHCSEVQCKSNEFRCESTNVCVPTVVVCDGWKDCHDGSDEKKCSHPRKTYKPHH
VHHVKVNAVCQDGSEPEFSLHGSSYCWSNKVCPAMTECVAGLCCSISKTRKRQSECLEGQ
FKCGTGQCIEESLKCNRKYDCADGSDEITCEYYLAVQKYHVEQQRQETQQSSAAAPTRAS
AAPAAPASMEHQSDNLVCNDQEFRCPYLAETRCFHYDRLCDGTDDCGDGSDETNCDSNEA
DQPAAPIPPPVPAPDSVEEDVSRCSSVQFECKRDGKCIDKALECNHKYDCEDGSDETECE
YFKAAMARRGESTSTSTTTTEQQHQRQHHQAQQAQQHQQQQERQQQERQQHERQQQERQQ
QDRQQQAQQHHQAQQHHSQQHPAQPAQPSQDHHEEHRRRLEEHRRREEEHHRRQEEESRA
RALQQSLLHASQVESTEVTFQDEYDGDSGVGCLEHEFQCAIGECIDKRRVCDTRPDCLDA
SDEQNCADRAPAPLPTHSQQHHHVAQPAAPPSLPSVNTYPDQDIDSDDDDTSDVQITVFP
SEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGT
YICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGE
PDCRDRSDEANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSS
DCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSL
TCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKG
RVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNC
DQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDAACDRLMFAGDAEGVTISDI
EERTIDRNTPFSFFKTGYLTFDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSGSG
HHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETNYEQLNGAAATREDLLM
VLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCED
CAPGYERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQCQCKASVIGPNCDRCAPNS
FGLAPTNPQGCIPCFCSGVTQQCSASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQT
RAELSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTSYGGTLEYTFKFSGNGNSDQSADV
ILRGNDIALQYKHREPFYADRENKVQIKIIETSWQRVDGQQATREHLLMTLADLDTLLIK
STYNDDCTDSQLLSANLEFAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGL
YLGLCEKCECNGHASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEAT
RAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCTPCPCPGAS
DCYLDNEGQVACRICPAGLQGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPH
EGGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQLGGPLPHGVYQTGNALK
IPQSQLHHAGRYICSAANQYGTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWV
PGNSNVQLRWSRPGGAPLPSGVQEQQGILHIPRASDQEVGQYVCTATDPSDNTPLQSEPV
QLNIRDPAPPQRGAAPQIDPPNQTVNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGIL
ERDGFLRIDKSQLHDAGEYECTSTEPDGSTQLSPPARLNVNQPQAIQPQVDPPVQTVNEG
EPSRIRCWVPGHPNIQLQFVKRGRRPLPAHARFSQGNLEIPRTLKSDEDEYICIATDPTT
NRPVESNPARVIVKSPIRPIIDPAEQTVPEGSPFKIRCYVPGHPSVQLTFRRVSGQLNED
ADENNGLLAVQRAELTDEGDYICTARDPDTGAPIDSTPATVHVTNAAAPPQVEARPPQHP
VITPQTQTIPEGDPARIQCTVPGNPSAAQHLSFERVDGKGLPFGSSDDRGVLTIPSTQLQ
DAGEYVCLYSPENSPPVKTNPSTLNVTPEGTPPRPVATPPLLSVAPGSPARFNCVAHSDT
PARIRWGFREENGPLPEHVNQDGDDIVISEAGDRNVGEYVCSATNDFGTGVADPVRLEVT
EDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPNGSPLPHDVTPLEPNILD
FSNGRSELNGDYTCTASNPIGEASDHGNVNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEA
FGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHA
TATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKGELICTATGSSLVDRLEWEKVDDQLP
TDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSANADDEPKVEIEPP
RVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLGTEPTLEITKADPSNDFGVY
RCNVEDNNGLVIGSAFTAVSVGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVDWTYEN
GDLPSKAVPNGNKIEIKEFDDASAGTYVCKVSFDGNVVEGFVTAQMFVPDTIIQVLLEVS
SESPQIGDRAWFDCKVTGDPSAVISWTKEGNDDLPPNAQVTGGRLLFTDLKEDNAGVYRC
VAKTKAGPLQTRTVLNVGSGKQDQVTFTVADSLPVVYTVGQPAYLSCIGKTETKPNQSVV
WTKEEGDLPSGSRVEQGVLMLPSVHRDDEGSYTCEIVKEENPVFSTVDLQIDDFIPVIDG
EPIELPPLSDEEIVNLDIEITLNTANPKGIIFETKRINSGDLLATPYDTIHHEAKITDYG
TVLYEFDIGNGRQIVETTNPINPNEWNVIKIKNDKNQVTIQLNDESATIRQHTNPLPSLS
TGVNRPVFIGGRHEPTNEANDFRGIISQVVLSGHNVGLGDARIPSSVVKYDACASTNLCL
NGANCRNANNHHGFSCECAEEFHGEYCQWRSNSCHDESCNTGICLDNEESWQCVCPLGTT
GLRCEEKTEIPQPLGFTSDTSFLAVKRPVKFESIKMKLRPQADSDEHILMYFASDYGSNT
KQYTSLSLIANQVVLTVRRPDKEVQKIRSETLEAGELIDVAVRQAGNALVMTVDGNQVST
IETDTLKPGTEIFIGGLPPGLNSPDDVVEQSFQGCVYEILINSQDVDLQNLSSSGDISSC
EESQFPVEEDDTTTTTTTEEPEAVIEEPTTEEPTTTEEPITEEPTEEPTTTEEPTTTEEP
TTTTEEPTTTTTEEPYHIYETSRDDDPEIIIPVETTTTSTTTTSTTEEPEAEPALVLPTD
PVEENDVSDEEEEISTISTVSPDNGLDSDSDYSEGTLPPDSSSEEIVVGDVYSTQEPNNI
CANSTCGMNGQCVPRNMTHYTCECKLYYDGPTCSLFKPIEHAARFDGDAFIELSSDEFPH
LTSEKDEIVAFKFKTEQQNGVLLWQGQRPTVQQMEDYISVGIVNGHLHFSYELGGGAAHL
ISEERVDDGKEHSVRFERKGREGQMRIDNYREVDGRSTGILAMLNVDGNIFVGGVPDISK
ATGGLFSNNFVGCIADVELNGVKLDLMATAIDGKNVKPCDEWMHRKRWLYRRRVR
NT seq 12228 nt   +upstreamnt  +downstreamnt
atggcgttttcgctgttctccgtcgtttcactgacggtcatctaccggttgaccatcaac
tttcccgaactaccgtacactcaggagttgaagaacgttgagagcgatgagttcgtgagc
acatctagagatatagctcattctattcaagagttggtcaaggatctagaaggaaggcat
acagctaaggttgccgattataaatatcacaaaatcattggatctcttgtctacgtggat
ttgtacgctgaaaaagagtcaccactggtgtctgatgtgttgttgtccgcgataaagtct
ggaaaaattgggaaccttacggtttccgatgagggttttgagcttcatgttgtaagagac
tcgtcaatagcctgcgccaccacagaattcacatgccttgacaagtcatgcatcccggcg
gatcaacgttgtgatggaagacgcaactgtccagatggatcagatgagcacaaggagcat
ggaaaatgcaagcagcatcaaccaatcatccatcaaactgagaaagttgtcttcgctcag
aaacatggatccatccatctctcggcttcaattgatagttcggtagaggataataagatt
gcttggtccaaagacagcgttcttcttggagttggctcgatgaccttggcagaagacggg
cgtgtgacggtttacaaaaaaggagacaaacatcatcttcatatcatcaacgccaccgac
gcagatgatggaacttataaaatgattgtgcaaggaataaatgtggaggctgattttgag
gtccgcatcacctccgaccgtgtcgccaccgaatccgacgaatgcccaagcggggagcgt
gcctgtaaatctggacattgccttccagtcgcccaattctgtgatcgccgagttcaatgc
ccagatggtgatgacgaggaacattgctctgaagtgcaatgcaaatcgaatgagttccga
tgcgagtccacaaatgtttgtgtgccaactgtcgtcgtctgtgacggatggaaagattgc
catgatggttctgatgaaaagaaatgctcccatccacgcaagacctacaaacctcatcat
gtccaccacgtaaaggtcaacgcagtttgccaagatggctcggagcccgagttcagtctt
cacggctcgagttattgctggtccaacaaggtgtgcccagccatgaccgaatgtgtggct
ggactgtgttgctccatttctaaaactcgaaaacgtcaaagcgaatgtttggagggacag
ttcaagtgtggaactggtcagtgcattgaagaaagtctgaaatgcaaccggaagtacgat
tgtgctgatggatccgatgagatcacttgcgaatactaccttgctgtccaaaaataccat
gtcgaacaacaaagacaagaaactcaacagtcttccgctgctgctccaactcgcgcatca
gctgctccagctgctccagcttccatggaacatcaatccgacaatctagtgtgcaacgat
caggagttcaggtgtccatatctcgccgagacccgttgcttccactatgatagactttgt
gatggaaccgatgactgtggagatggatccgatgagaccaactgcgactccaatgaggcc
gatcaaccagctgctccaattccaccgccagtgccagctcctgactcggtggaagaggat
gtgtcgagatgttcgagtgttcagtttgagtgtaagagagatggaaagtgcattgataag
gctttggagtgtaatcataaatatgactgtgaagatggatcagatgagactgaatgtgag
tacttcaaagcagctatggctagaagaggcgaatctacttcaacctccaccactactaca
gagcaacaacatcaacggcaacatcatcaggcgcagcaagcccaacaacatcagcaacaa
caagaacgtcagcaacaagagcgtcagcaacacgagcgtcagcaacaagagcgtcaacag
caagaccgccagcaacaagctcaacaacatcaccaagcccagcagcatcattctcagcaa
catccagctcaaccagctcaaccttcgcaagatcatcacgaggaacatcgtagacgtctc
gaggagcatcgccgccgagaagaagaacaccatcgtcggcaagaggaggagtcgcgtgcc
agagctcttcagcaatcactgctacatgctagccaggttgagagcaccgaagtgacattc
caagatgagtatgatggagatagtggagttgggtgcttggagcacgagttccagtgtgct
attggagagtgtattgataaacgccgtgtgtgcgacactcgtcccgactgcctcgatgcc
tctgacgagcaaaactgtgcggaccgggctccagctcctctaccgactcattcacagcaa
catcatcatgttgcgcaaccagcagcaccaccatcactcccatcagtgaacacttatccg
gaccaagacattgactcagacgacgatgacacctctgacgtccaaatcacagtgttccca
tccgagaaggaggttcgcgacggacgtgacgtctccttcgaatgccgtgcccgtacttct
gacaactctgtttatccaacagtccgatgggcacgtgttggtggaccacttccatcttct
gctcatgattctggaggtcgtcttaccatcaatccagttcaactttcggatgctggtaca
tacatctgtgtgtcggactacaatggaaacacggttgaagcaagagctacgttgagtgtt
gtgtcttacggaccccaagaagtctcgaacggactccgtcaggccggccaatgcatggct
gacgagaaggcgtgcggaaacaacgaatgcgttaagaacgattatgtctgcgacggagag
ccagactgtcgcgatcgatccgacgaggccaactgcccggcaatctcgagaacttgcgag
ccgaacgagttcaagtgcaacaataacaagtgcgtgcaaaaaatgtggctttgcgatggc
gatgacgattgtggagacaactctgacgagcttaactgcaacgccaaaccaagcagcagt
gactgcaagccaaccgagttccaatgccacgaccgtcgccaatgtgttccatcgtccttc
cactgtgacggaaccaacgattgtcacgatggttctgacgaggtcggatgcgtgcagcca
accgtcgtcgatccaccacaaaccaaccttcaagtgccacgtggaacaacgttctcgttg
acctgtaaggccgtcgccgtaccggagccttacatcaattggcgtttgaattggggacca
gtttgcgagcccccacgctgtctgcagacttccgaaggaggttatggtacattgaccatt
catgatgctcaaccagtcgaccagggagcctacacttgcgaggcgatcaacgtgaagggc
cgcgtgctcgccaccccagactgcatcgttcgcgtcgtcgatgatccacgtccacaacca
ccacagccaccaaccgctccaccacagagagccagctgtgacactcgtggagccgtcacc
ccatacccgaacaactatggaacctgcgagtgcaagagccaagtcaccggaccaaactgt
gatcagtgcaagccaggagcattccacttgtctgagaagagcccagagggatgcttgaag
tgcttctgctttggagtatcgaatgattgtcgcagcagtggacactaccgtaccaaggac
gccgcttgtgaccgtcttatgtttgctggagatgccgaaggagtcaccatttcggatatc
gaggagagaactattgaccgaaatactccattttcgttcttcaagaccggataccttacc
ttcgacggcaccactgatggagttgccaagtactggcgtcttccacagcgattcctcgga
gacaaggtcacagcctacggcgggaagatggagtttgagattgagttctccggttccgga
catcatagcagtgagccgatggttgttctcaagggtaaccagaacatcttggtccaccgc
gtccgcaaccaagagcatgttctccggtcagactcccctgttagaattacagtggagacc
tatgagactaactatgaacaactcaatggagccgctgcaactcgtgaggatcttctcatg
gttcttgctgatcttgacgcgttcctgatccgagccactcacgttgcccatcagacttcc
acctcacttggtgatgtctcctgggagatcgcagtagaccgctatacccctgatggtctt
gcacttgaagttgaacagtgcgtctgtccaccaggatatcttggaacatcctgtgaggat
tgcgctccaggatacgagcgcagtggctacggcccatacctcggaacctgtgtcccaatt
caaccaagacatcagcagtgcgggccaggagccgtcgctccaactgcaccagctcaagga
cagtgtcaatgtaaggcgtcggtgatcggaccaaattgtgatcgatgcgcgccgaactcg
ttcgggctcgctccaactaacccacaaggatgtattccttgcttctgctcaggtgtcact
caacaatgttctgcttccagctatcgaagaacaagcgtttctattgattatgctcgtggg
gatcgtgaccagctcgagctcaccacctcggactcccgccaaccatactctccacaaacc
cgtgccgagctttctggacaagccattgagttcagaagcttcgaggaggctcgcggacag
actttgtactggaagcttccagagaagtttttgggagataaggtaacctcgtacggagga
actttggagtacaccttcaagttctctggaaatggcaactccgatcagtccgctgatgtc
attcttagaggaaacgacattgctcttcaatacaagcacagagagccattctacgctgac
agagagaacaaggttcaaatcaagattattgagactagctggcaacgagttgatggtcaa
caagcaacccgcgagcatctcctcatgactctcgccgatcttgacacccttcttatcaag
tccacctataacgatgactgcaccgattctcaacttctctctgccaacctcgagtttgct
gaaccatacggtcaaggactcaccgctgctgaagtcgaacagtgcatctgcccacctgga
tacgttggaacttcctgcgaggactgtgctccaggatactccagaaccggaggaggactt
taccttggactttgcgagaagtgcgagtgcaacggacacgctagccaatgcgacaaggag
tacggttattgcttggattgtcaacacaacaccgaaggagatcagtgcgaaagatgcaag
ccaggatttgttggtgatgctcgtcgtggaactccaaatgactgccaaccagaagccaca
cgcgccccatgccattgcaacaatcactccccaagaggttgtgattcgttcggaagatgc
ttgctctgtgagcacaacaccgaaggaacgcattgcgagagatgcaagaagggctactac
ggagatgctaccaagggatccccatacgattgtactccatgcccatgcccaggagcctcc
gactgctacctcgataacgaaggacaagtggcgtgccgcatctgtccagccggactccag
ggacgcttgtgcaacgagtgtgctccaggatacacccgctcaaacaagccagccggacgc
gtgtgcgaaccaatcggacaggtcaccaacgaggacatcacgtttgtgcagaagccacat
gaaggcggacgcccaccacagccggtaatcgatccaccacatcttgttgtcaacgaagga
gagccagcagccttccgttgttgggttccaggtataccagattgccagatcacctggcat
cgtgagcaactgggtggaccacttccacatggtgtctaccagactggaaatgcgctcaag
attcctcaatctcaacttcatcacgccggaagatacatttgttctgccgccaaccagtat
ggaaccggacagagtccacccgcagtgcttgaagttaaaaaacctgtgatcccaccaaag
gtcgacccaatccgtcagaccgttgatcgtgaccaaccagctcgtttcaagtgctgggtg
cccggaaactccaatgtccaactcagatggtctcgtccaggaggtgctccacttccaagc
ggagtccaagaacaacaaggaatccttcatatcccacgtgcctctgatcaagaagtcgga
caatacgtgtgcaccgccaccgatccatcagacaacactccacttcaatcggagccagtg
cagctgaacatcagagatccagccccaccacaacgtggcgccgctccacaaatcgaccct
ccaaaccagacagtcaatgtgaacgatccagctcagttcagatgctgggttccaggacaa
ccacgtgctcagctcaaatggtctagaaaggacggaagaccacttccaaatggaattctc
gaaagagatggattcctgagaatcgacaagtcccaattgcatgatgctggagagtacgag
tgtacttccactgaaccagatggcagcacacaactatcaccacctgccagacttaatgtt
aatcaaccacaagccatccaaccccaagtcgatccaccagtgcaaactgtcaatgaagga
gaaccatcgcgaatccgctgctgggttcccggacatccaaacatccaactccagtttgtc
aaaagaggccgtcgtccattgccagcacacgccagattctcccaaggaaaccttgagatt
ccaagaaccctcaagtcggacgaggatgagtacatctgtatcgccacggacccaaccact
aacagacccgttgaatcgaatccagccagagttatcgtcaagtcgccaattcgtccaatt
atcgacccagccgagcaaaccgtgccagaaggatcacccttcaaaatcagatgctacgtg
cccggacatccaagtgttcagctcacgttcagaagagtctcgggacaacttaacgaggac
gccgatgagaacaatgggctcttggctgttcagagagccgagctcaccgacgagggagac
tacatctgtaccgctcgtgatccagataccggagcgccaatcgactcaaccccagcgacc
gttcatgttaccaacgccgctgctccaccacaagtcgaagctcgtccaccacagcaccca
gtgatcaccccacaaacacagacaatccctgaaggagatccagcacgcattcagtgtaca
gtacccggaaacccatcggctgctcagcatctctccttcgagagagttgacggaaaaggg
cttccatttggatctagtgatgatcgtggagtcttgacgattccgtcgacacaattgcag
gatgccggagaatacgtttgtttatattccccagagaatagcccaccagtgaagacaaac
ccaagcaccttgaacgtcacacctgaaggcactccaccacgtccagttgccacaccacca
cttctttccgtggcacctggctcaccagcacgattcaactgtgtcgcgcactcggacact
ccggcacgcatcaggtggggattccgagaggaaaatggacctcttccggaacatgtgaac
caggatggagatgatattgtgatctctgaagccggcgatagaaatgtcggggaatacgtg
tgctcggccactaacgattttggaaccggagtcgcggatccagtcagactggaagtcact
gaggaccaagagcctccaacagccgtcgtggagccacgaacctggaatgggaagccagga
gagcgacatcagttcagatgtattactacaggatcgcctactccaaagattacatggact
ggacccaacggatcacctctaccacacgacgttacaccgcttgagccaaatattctcgac
ttctccaacggccgctccgagctcaacggagactacacttgcacagcttcgaatcctatt
ggagaggcttccgatcacggaaacgtcaacatcggaccgtctcttacggttaaaacgaat
ccacccggaccaaaattgatcgtgacagttggcgaaccacttcaagtaaaatgcgaggca
ttcggcgccccaggagatccggagccagaagtcgaatggctccatgacccaggaccggag
cgtggagatcttccagatgacttcaagccagtcaccatctcagaacagttcatcagacat
ccaaatgtcggacttggaaatgccggagtttacacttgcaagggatccagcgcacacgct
actgccaccaagaacatctacatcgaagtcgtcgagccatctagaattgctactgtgtct
atcctcggaggatcatcccaatggttcgatcaaggagagaagggagaattgatctgtacc
gctactggaagctctcttgttgataggctcgaatgggagaaggttgatgatcaacttcca
actgacgtcgaagagcataatgagccaggacttttgcacttcccaagctttaagaattca
tacgccggcgagtaccgttgcaacggctaccgtaacaacgagatcatcgcttccgccgcc
gttcatgttcactcttccgccaacgctgacgatgagccaaaggttgaaatcgagccacca
cgcgttcgtgttgtctcccagggagataatattgtgctcaagtgctctgttcaaggagcc
gaaaacggtgaacacttcaagtgggctctcctccgtggcggatcccttgtccgtcaactt
ggcaccgagccaactctcgagatcaccaaggccgacccgtcaaacgattttggagtttat
agatgcaatgtcgaagataacaatggattggtcatcggatctgcgttcaccgcggtttcc
gttggacaacaggacaaatctcatgctcaaatcgtgaagttcgacgataaatccgatgcg
tccttcacctgcccaatctactcggtaccaggatcaaaggtcgactggacctacgaaaac
ggagatcttccatccaaggcagttccaaatggcaacaagattgagatcaaggaattcgac
gatgcatctgctggaacctatgtttgcaaggtttcgttcgatggaaacgttgttgaagga
tttgtgaccgctcaaatgtttgtacctgatactattatccaagtgcttctcgaagtttcc
tctgaatcaccacaaatcggggatcgtgcctggtttgactgtaaggtaactggagaccca
tcggctgtgatctcatggaccaaagaaggaaatgatgatcttccaccaaatgctcaggta
accggaggacgtctcttgttcactgatctcaaggaagacaacgctggcgtctacagatgc
gtcgccaagacaaaagcgggaccacttcaaacacgaacagtgctcaacgtcggatccgga
aaacaagatcaagtcacttttactgttgccgactctttgcctgttgtctataccgttggt
cagccagcctacctgtcttgtataggaaaaactgagacaaaaccaaatcaatcggtggta
tggacaaaagaggaaggagatcttcctagtgggtctcgagtggaacaaggagtactgatg
cttccatctgttcatagagatgatgagggatcatacacctgtgaaatagtgaaagaagaa
aatccagttttctccaccgtcgatcttcagattgatgattttataccggttatcgatgga
gagccaattgaacttccaccacttagtgatgaagagattgtcaatttggatattgaaatc
actttgaacactgcaaatccaaaaggaataatttttgaaacaaaacgaatcaactccggg
gatcttttggctactccatacgatactattcatcatgaggcaaaaatcactgactatgga
actgttctgtatgagtttgatattggaaacggtagacaaattgtggaaacaaccaaccca
ataaatccgaatgagtggaatgtgattaaaatcaaaaatgataagaatcaggtgacaatt
cagctgaatgacgagtccgcgacaataaggcaacatacaaatccacttccaagtctgagc
accggagtaaaccggccagttttcattggaggaagacatgagccaacaaatgaagctaat
gatttcagaggcattatcagtcaagttgtactctccgggcataacgttgggcttggtgac
gctcgtattccatcttcggtggtcaaatacgacgcgtgtgcgagcacaaacctctgcttg
aacggagccaactgcaggaacgccaacaatcatcatggtttcagttgtgaatgtgccgaa
gagttccatggagaatactgtcaatggagatccaatagttgtcatgatgaaagttgcaac
actggaatttgcctggacaacgaagaaagctggcaatgtgtctgtccgctggggactacg
ggtctacgatgtgaagaaaaaactgaaattcctcaacctttgggtttcacatctgacacc
agcttcctggctgtcaagagacctgtaaaatttgaatcgataaaaatgaaactaagaccg
caagctgatagtgatgagcacatcttaatgtattttgcatcggattatggatcaaatact
aaacagtatacttcactttcattgattgctaatcaagtggtactcactgttcggagacct
gataaagaagttcaaaagatcagaagtgagactttggaagctggtgagcttattgatgtg
gcagtacggcaggctggcaatgctctagtaatgactgtagatggaaatcaagtttctacc
atcgaaactgacacattgaaacctggcacagaaatatttattggtggtcttccgccaggt
ctgaactcccccgatgatgttgtagagcagtccttccaaggatgtgtctatgagatactg
atcaactcgcaggacgtagatcttcaaaatttgtcctcgtcaggtgacatttcgtcctgc
gaggaatcgcagtttccggtagaggaagatgatacaacaaccacaacgactacagaagaa
ccagaagctgtgattgaggagcctacgacggaagagccgactacaactgaagagcctatt
acagaggaaccaactgaagagccaactactacggaggagccaactaccactgaagagccc
accacgactactgaagaaccaacaacgacgactactgaggagccctaccacatttatgag
acgtcaagggatgatgatccagaaatcataattccggtagagacaacaacaacatccaca
actacgactagtaccactgaagagccggaagcggagccagcactggttcttccaacagat
cccgttgaagaaaatgatgttagcgacgaagaagaagagatttccactatcagcacagtt
tccccggataacggtttagattccgattcggactacagtgagggtactctgcctccagat
tcaagttctgaagagattgtcgtgggcgatgtgtattctactcaagaacccaataatatc
tgtgcaaattcaacgtgtggaatgaacggacaatgtgtgccaagaaacatgacgcattat
acgtgtgaatgcaaactttactatgatggcccaacctgtagccttttcaagccaatcgaa
cacgcagctcgatttgacggagacgcatttatcgagctttcgtcagatgagttcccacat
ttgacatctgaaaaggatgaaattgtggcgttcaagttcaaaaccgagcaacaaaatggt
gtgctgttgtggcaaggacaacgtcctaccgttcaacaaatggaggactatatatcagtt
ggaattgtcaatgggcatctgcacttttcctacgaacttggtggtggagctgcgcatctt
atctccgaagaaagagtagatgatggaaaagagcacagtgtgagatttgaaagaaaggga
agagaagggcaaatgcgaattgacaactaccgtgaagtcgacggtcggagcacgggaatc
cttgcgatgctcaatgttgacgggaatattttcgttggcggggtgcctgatatctccaaa
gccaccggtggcttgttctccaacaactttgtcggatgcatcgctgacgtagaattgaat
ggggtgaagttggacttgatggccactgcgatcgatgggaagaatgtaaagccgtgtgat
gagtggatgcataggaaacggtggttgtatcgaagacgagtgcggtga

DBGET integrated database retrieval system