KEGG   Canis lupus familiaris (dog): 100630922
Entry
100630922         CDS       T01007                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cfa01002]
    100630922 (ADAMTS13)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100630922 (ADAMTS13)
Peptidases and inhibitors [BR:cfa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100630922 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 TSP_1 Reprolysin Reprolysin_4 Reprolysin_3 TSP1_spondin Reprolysin_5 ADAM_spacer1 Peptidase_M10 DUF4953 Reprolysin_2
Other DBs
NCBI-GeneID: 100630922
NCBI-ProteinID: NP_001229641
Ensembl: ENSCAFG00000019776
VGNC: 37592
UniProt: F7J124
Position
9
AA seq 1502 aa
MREPRPWGRCVGAILTSVFFLLGCWGLSDFQQQFLQALDPEEVTSYFGPEATLKAPPFDV
APLSCICEDGTGVPPCRALSCSLHIWGQLFTISFPPEWSLFTTSFTSELVLNASLQLLRR
LPHLCFLGGRPLLPLGAAARVTYCSGHLEGDILVGADLFYIQPVKMQHRELVPPWALAQP
HLIHRPFPKAPTAPKALNTIREASLSAPLPPSPGRPRSPRLRRWVAGSVLHLELLVAVGP
DVYQAHQEDTERYVLTNLNMGSELLRDPSLGAQFQVHLVKMVILTQPEDAPNITANITAS
LLSVCEWSRTVNPEDDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSSSWSCVI
TEDTGFDLGVTIAHEIGHSLGLEHDGATGSGCKPSGHVMGSQDRAAARGDLLWSACSRQQ
LLHLLSTGRLRCLGDLPEPQAGASGRLPQAQPGLLYGMDEQCRVAFGAGAVACTFTREHL
DMCQALSCHTDPLDQSSCSRLLIPLLDGTECGVQKWCSKGHCRSLAELSPVGVVHGQWSS
WSPPSLCSRSCGGGVVTRRRHCNNPRPAFGGHVCVGADLQAEMCNTQACEKTQLEFMSEQ
CSQTDRKPLYLTPGNASFYRWGSAEQYSQGDALCRHMCRAIGEAFIVRRGESFLDGTRCV
PSGQREDGTLSLCMLGSCKTFGCDGRMDSQQVRDVCQVCGGDNSTCSPQNGSFTAGRARE
YVTFLTVTRNLTSVHITNRRPLFTHLAVRIRGHYIVAGNSSISPSTTYPSLLEDSRVEYR
VTLTKDRLPHLEEISIRGPTQEDMEIQVYRRYGEEYGDLARPDITFTYFEPKQPQAWAWV
AVRGSCSVSCGAGRRWVTYSCLDQARNVWVEAARCEGSQQPAAWSESCTPRPCPPQQEAS
DACTTACGADLASQNVTCVHRVAGLETLATAGPCSTDEKLPALKPCVATACPPGQGYPDL
QSLEEEKEATSPSGSAGLRARTTHMWTPLAGPCSASCGQGLTELNFMCMDSALGTPVREE
LCDLESKPGSRQEVCQAAPCPAWWRYKLAACSVSCGGGFAQRMLYCARAHGEDEDEEILP
DTQCQGLPRPEQQEACSPEPCPPRWKIMSLGPCSASCGFGTATRSVACVQLSQGQDIEVD
GAACAALVRPQASIPCILAYCTYRWHVSTWTQCSVSCGDGIQRRRKACLGPQAQAPVLAD
FCQHLHKPATVRGCWAGPCGGQVTPRPAPNEEATAPDQATAGASPEWPQPQAHLLSPAPP
LQRLLPGSQENPAESSACGRQHLEPMGTIDMRGPGRADCAVAIGRPLGEVVTLQVLESSL
SCSAGDVLLLWDRLTWKKMCGKLSGMTFSSKTNTLVVRQRRVRLEGGVVLRYRSRPAPGA
PHRECDMQLFGPWGEIVSPSVGADGRNSGGCRIFINVAPQARIAIHALATDGTGTGASYV
LIRDIHSLKTMTFRGQQALYWESEGSQAEMEFSQGFLEAHASLRGQYWTLQSRVQEPGWA
EP
NT seq 4509 nt   +upstreamnt  +downstreamnt
atgagggagcctcgcccctgggggagatgtgtgggggcaattctcacatctgtcttcttt
ctcctgggctgctggggactctccgatttccagcagcaatttcttcaggctttggacccg
gaggaagtgacttcttattttggccctgaagctaccctaaaagcacccccatttgacgtg
gccccgctcagctgcatctgtgaagatggaaccggggtacctccctgccgggccctgagc
tgctccctgcacatctggggacagctcttcaccatctccttcccgcctgaatggagcctc
tttaccacctccttcaccagtgagctcgtcctgaacgcctccctccagctcctcaggcgg
ctgccccatctctgcttcttggggggccgccccctgctgcccctgggggccgcggccagg
gtcacttactgctcaggccacttggagggtgacatcctggtgggtgcagacctgttctac
atccagccagtgaagatgcagcaccgggagctggtgccaccctgggctcttgcccagccc
cacctgatccacaggcctttccccaaggcccccacggcccccaaggcccttaacaccatc
cgagaagcttcgctgtcagccccgcttcctccctcaccaggccgtcctcggtcccctcgc
ctccggagatgggttgctgggagtgtcttacacctggagctgctggtggccgtgggcccc
gacgtctatcaggctcaccaggaggacactgagcgttatgtgctcactaacctcaacatg
gggtcagagctgctgagggacccatccctgggggctcagttccaagtgcatctggtgaaa
atggtcattctgacccagcccgaggatgctccgaacatcacggccaacatcacggcatca
ctgctgagtgtctgtgagtggagcaggacagtcaaccctgaggacgacacagatcctggc
catgccgacctggttctctacatcaccagatttgacctggagttgcctgatggtaaccgg
caggttcggggagtcacccagctggggggtgcttgctcatcttcctggagctgtgtcatc
actgaggatactggctttgacctgggggtcaccatcgctcatgagattggtcacagcctg
ggcctggagcacgacggcgcgaccggcagcggctgcaagcccagcggccatgtgatgggc
tcccaggaccgagcggccgcccgtggggacctcttgtggtctgcctgcagccgccagcaa
ctgctgcatctgctcagcacaggacggttgcgctgcctgggggacctgccagagccacag
gctggggcctccgggcgccttcctcaggcacagcctggcctcctgtacggcatggacgag
cagtgccgggtcgccttcggcgctggggcagtggcctgcaccttcaccagggagcatctc
gacatgtgccaggctctgtcctgccacacggatcccctggaccaaagcagctgtagccgc
ctcctcatccctctcctggatgggacagagtgcggcgtgcagaagtggtgctccaagggt
cactgccgctccctggcagagctgagcccagtgggggtagtgcatgggcagtggtctagc
tggagtccccccagcctttgctcccgctcctgcggaggaggtgtggtcaccaggaggcgg
cactgcaacaaccccaggcctgcctttggagggcatgtgtgcgtgggtgctgacctccag
gcggagatgtgcaacacccaggcctgtgagaagacccagctggagttcatgtctgagcag
tgctcgcagacggacaggaaaccgctctacctgaccccggggaatgcctccttctaccgc
tggggctccgctgagcagtacagtcaaggggatgccctgtgcagacacatgtgccgggcc
attggcgaggccttcattgtgaggcgtggggaaagtttcctagatgggacccggtgtgtg
ccaagtggtcagcgggaggacgggaccctgagcttgtgcatgttgggcagctgcaagaca
ttcggctgtgatggcaggatggactcccaacaggtgcgagacgtgtgccaggtgtgcgga
ggggacaacagcacctgcagcccacagaacggctctttcacagctggaagggccagagaa
tatgtcacattcttgacagttacccgcaacctgaccagtgtacacatcaccaaccggagg
cctctcttcacacacttggcggtgcggatccgagggcactacatcgtggctgggaattct
agcatctctcccagcaccacctacccctccctcctggaggacagccgtgtggagtacaga
gtgaccctcaccaaggaccggctgcctcacctggaggagatctccatccggggacccacc
caggaagacatggagatccaggtttacaggcgctacggggaggagtatggtgaccttgca
cgcccagacatcaccttcacctacttcgagcctaagcagccacaggcctgggcctgggtc
gccgtgcgggggtcctgctcggtgagctgtggggcagggcggcgctgggtgacctacagc
tgtctggaccaggccaggaacgtgtgggtggaggctgcccggtgcgaagggagccagcag
ccagcagcgtggtcagagtcctgcacccccaggccctgccccccacagcaggaggcatcg
gatgcatgcacaacagcctgtggagcagacctggcatcacagaatgtgacgtgtgtgcac
agggtagctggcctggagacactggccacggctggaccctgctccacagatgagaagctg
cctgccctcaagccctgtgtggccacggcatgtcctccgggacagggttatccagacctc
cagtctctggaggaggagaaggaggccacatccccatcaggaagtgctgggctgagggct
cgcaccacacacatgtggacccccctggcagggccatgctctgcctcctgtggtcaaggc
ctgacagagctgaacttcatgtgtatggactctgccctgggaacccctgtccgggaagag
ctatgtgacctggaaagcaagcctgggagccggcaggaggtctgccaggctgccccatgc
ccggcttggtggaggtacaagctggccgcatgcagtgtgagctgtggaggagggtttgcg
cagaggatgctatattgtgcacgggctcacggggaggacgaggacgaggagatcctgcca
gatacccagtgccaggggctgcctcgtccagagcagcaggaagcctgcagcccagagccc
tgcccacccaggtggaaaatcatgtccctcggcccatgctcagccagctgtggctttggc
actgccacacgttctgtggcctgtgtgcagctcagccaaggccaggacattgaggtggat
ggggcagcctgtgcggctctggttcggcctcaggccagcatcccctgcatcctcgcctat
tgcacctaccggtggcatgtcagcacctggacacagtgctctgtctcctgcggagatggc
atacagcgcaggcgtaaggcctgccttggaccccaggcccaggcacctgtgctggctgac
ttctgccagcacttgcacaagccagccactgtgcggggctgctgggccgggccctgtggt
gggcaggtgactcccaggccagcacccaacgaggaagccactgctccagaccaggccact
gctggtgcctctccggagtggcctcagccccaggcccaccttctatccccagcacccccg
cttcagaggcttctgcctgggtctcaggaaaacccagctgagtccagtgcctgtggccgg
cagcatcttgagccaatgggaactattgacatgcgaggcccagggcgggctgactgtgca
gtggccattgggcggcccctgggtgaggtggtgaccctccaagtcctcgagagttccctc
agctgcagtgctggggatgtgttgctgctttgggacaggctcacgtggaagaagatgtgc
gggaagctatctggcatgacttttagctccaagaccaacacgctggtggtgaggcagcgc
cgcgtgcggctggaaggtggggttgtgctgcggtacaggagccggcctgcaccgggagcc
ccccaccgagagtgtgacatgcagctcttcggaccctggggggaaatcgtgagcccctcc
gtgggtgctgatgggaggaactcagggggctgccgcatcttcattaatgtggccccacag
gcccgaattgccatccatgccctggccactgatggcacaggaaccggtgccagctatgtc
ttgatccgggacatccacagcctgaagacgatgacattccgtgggcagcaggcactctac
tgggagtcggagggaagccaggctgagatggagtttagccagggcttcctggaggcgcat
gccagcctgcgaggccagtactggaccctccaatctagagtgcaggaacctggctgggct
gagccctag

DBGET integrated database retrieval system