KEGG   Canis lupus familiaris (dog): 100856456
Entry
100856456         CDS       T01007                                 

Gene name
JUNB
Definition
(RefSeq) transcription factor jun-B
  KO
K09028  transcription factor jun-B
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04380  Osteoclast differentiation
cfa04668  TNF signaling pathway
cfa04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100856456 (JUNB)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100856456 (JUNB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100856456 (JUNB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    100856456 (JUNB)
Transcription factors [BR:cfa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    100856456 (JUNB)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 MAD DUF737 DivIC
Other DBs
NCBI-GeneID: 100856456
NCBI-ProteinID: XP_003639770
Ensembl: ENSCAFG00000028848
VGNC: 42198
UniProt: J9NRZ4
Position
20
AA seq 347 aa
MCTKMEQPFYHDDSYAAAGYGRAPGGLSLHDYKLLKPSLALNLADPYRSLKAPGARGPGP
EGSGGSSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG
AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGASSGPPAGPGGVYAGPEPPP
VYTNLNSYSPASAPSGGAGAAVGTGSSYPTATISYLPHAPPFAGGHPAQLGLGRGASTFK
EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV
KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgtgcactaaaatggaacagcccttctaccacgacgactcatacgcagcggcgggatac
ggccgggctccgggcggcctttctctacacgactacaaactcctgaaacccagcctggcg
ctcaacctggccgacccctaccgaagtctcaaagcccccggggcgcggggcccgggacca
gagggcagcggtggcagcagctacttttccggccagggttcggacacaggcgcgtcgctc
aagcttgcctcatcggagctggagcgcctgatcgtccccaacagcaacggagtgatcacg
acgacacccacgcccccgggacagtacttttacccccgcgggggaggcagcggcggaggt
gcggggggcgccgggggcggtgtcaccgaggagcaggagggcttcgcagacggctttgtc
aaagcgctggacgacctgcacaagatgaaccacgtgacgccccccaacgtgtccctgggc
gccagctcggggcccccggctgggcccgggggcgtctacgccggcccggagccacctcca
gtctacaccaacctcaacagctattccccagcctctgcgccctctggaggcgccggggcc
gccgtcgggactgggagctcgtacccgacggccaccatcagctacctcccacacgcgcca
cccttcgctggcggccacccggcgcaactgggcctgggccgaggagcctccaccttcaag
gaggaaccgcagaccgtgcctgaggcgcgcagccgcgacgccacgccaccggtgtccccc
atcaatatggaagaccaggagcgcatcaaagtggagcgcaagaggctgcggaaccggctg
gcggccaccaagtgccggaagcggaagctggagcgcatcgcgcgcctggaggacaaggtg
aagacactcaaggccgagaacgcggggctgtcgagcactgctgggctcctccgggagcag
gtggcccagctcaaacagaaggtcatgacccacgtcagcaacggctgccagctgctgctc
ggggtcaagggacacgccttctga

DBGET integrated database retrieval system