KEGG   Canis lupus familiaris (dog): 403440
Entry
403440            CDS       T01007                                 
Symbol
HSPG2
Name
(RefSeq) basement membrane-specific heparan sulfate proteoglycan core protein isoform X1
  KO
K06255  basement membrane-specific heparan sulfate proteoglycan core protein
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04512  ECM-receptor interaction
cfa05161  Hepatitis B
cfa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    403440 (HSPG2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    403440 (HSPG2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    403440 (HSPG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    403440 (HSPG2)
   00535 Proteoglycans [BR:cfa00535]
    403440 (HSPG2)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   403440 (HSPG2)
Proteoglycans [BR:cfa00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   403440 (HSPG2)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig Laminin_B V-set Laminin_G_1 Laminin_G_2 Laminin_EGF Ldl_recept_a C2-set_2 Ig_6 Laminin_G_3 EGF hEGF
Other DBs
NCBI-GeneID: 403440
NCBI-ProteinID: XP_038319266
Ensembl: ENSCAFG00000014773
VGNC: 41820
Position
2:73772098..73871430
AA seq 4572 aa
MGQRAAGALLLALLLHGRLLAVTHGLRAYDGLSLPEDAETVTVGRAGWSYSDLSDDEDLL
ADDASGDGLGSGDLGSGDFQMVYFRALVNFTRSIHYSPQLEDAGSEEFREVSEAVVDTLE
SEYLKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGAQIQEVLHTVISSGSVASYITS
PQGFQFRRLGTAQTPPPPPAAVAAAVTPVPQFARVCTEAEFACHSHNECVALEYRCDRRP
DCRDMSDELNCEEPVPELSSIPPALVETPPPPVEPQPEATTTRQLPGSPTPQLLLPSPSR
PLPCGPHEATCHSGHCIPKDYICDGQEDCKDGSDELDCGPTPPCEPNEFPCGNGHCALKL
WHCDGDFDCEDRTDEVDCPAKRPEDVCGPTQFRCVSTNTCIPASFHCDEESDCPDRSDEF
GCMPPQVVTPPQESIQVSRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR
GTLTIRDVKEADQGAYTCEAMNARGMVFGIPDGVLELIPKRGPCPDGHFYLEHSASCLPC
FCFGVTNVCQSSRRFRDQIRLRFDQPDDFKGVNVTMPAQPGMPPLSSTQLLIDPALQEFQ
LVDLSRRFLVHDSFWVLPEQFLGNKVDSYGGFLRYKVRYELARGMLEPVQRPDVVLVGAG
FRLLSRGHVPTQPGTLNQRQIQFSEEHWVHESGRPVQRAEMLQVLQSLEAVLIQTVYNAK
MASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYAGLSCESCDAHFTRVPGGPYLGTC
SGCNCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKAGFFGDATKATATACRPCPCPYIDA
SRRFSDTCFLDTDGQATCDACAPGYTGRRCESCAPGYEGNPIQPGGKCKPTNQEIVRCDE
RGSVGTSGEACQCKLPALCLQNNVVGRLCNECVAGSFHLSTRNPDGCLKCFCMGVSRQCT
SSSWRRAQVQGASEEPGQFSLTNAAGTHTTSEGISSPLPGELVFSSFHSLLTGPYFWSLP
SRFRGDKVTSYGGELRFTVTQRPQPGSTPLHGQPLVVLQGNGIVLEHHTSQEPSPGQPST
FTVPFREQAWQRPDGQPATREHLLMALAGIDTLLIQASFSQRPAESRVSGISMDVAVPED
TGQDPALEVEQCTCPPGYRGPSCQDCDTGYTRMPSGLYLGTCERCSCHGHTEVCEPETGT
CQGCQHHTEGPQCEQCQPGYYGDAQRGTPQDCQPCPCYGAPAGGQATHTCFLDTDGHPTC
DACSPGHSGRHCERCAPGYYGNPSQGQPCQRDGQLPEPIGCGCDPQGSVSSQCDAAGQCH
CKAQVEGLTCSHCRPHHFYLSASNPDGCLPCFCMGITQQCVSSSYTRHLISTHFAPGDFQ
GFALVNPQRNSRLTGGFSVEPVPEGAQLSFSNFAHLGHESFYWQLPEPYQGDKREAYFAQ
MRRAHKNRTSLSEEQLRTAMTPGRTMGPPKGRGRAQRPSQLDEAQRRMDAEIWELLSSFA
AHPHPPAGGLLSRPQPAAALQAAPLSSSSSFSSSSSASGPSSAGSQFSLSYKGFSRLPGS
LYYWQLPQAFLGNKVAAYGGKLRYTLSYTAAGQGSPLSDPDVQITGNNIMLVASQPALQG
SERKSFEIIFREEFWRRPDGQPATREHLLMALADLDELLVRATFSSMPLATSINSVSLEV
AQPGPSEGPRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLYLGHCELCECNGHSDVCH
PETGACSQCQHNAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNPENMFSRTCESLGA
GGYRCTACELGYAGQYCEQCAPGYVGNPSVRGGRCLPQADAAPLVVQVHPARSIVPQGGS
HSLRCQVSGSPPHYFYWSREDGRPVPGSTQQRHQGSELHFPSVQPSDAGVYICTCRNLHH
ANTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSPAYTLVWTRLHNGK
LPTRAMDFNGILTIRNVQPSDAGTYVCTGSNMFAMDQGTATLHVQASGTPSAPVVSIHPP
QLTVQPGQLAEFRCSATGSPAPTLQWTGGPGGQIPQKAQIHGGILRLPNIEPSDQAQYLC
RAHNSAGQHVARAVLHVHGGSGPRVQVSPERTQVHEGRTVRLYCRAAGVPSTTITWRKEG
GSLPPQARSERAEIATLLIPAITAADAGFYLCVATSPAGTAQARIQVVVLPASGASSPPV
RIESSSPTVTEGQTLDLNCVVAGLAHTSITWYKRGGSLPPHSQVHGSRLRLPQVSPADSG
EYVCRVENEAGAKEASIIVSVFHSTHSGSSYTLAPEGAPAPGGSQPIRIESSSSHVAEGQ
TLDLNCVVPGQAHAQVMWHRRGGSLPARHQTHGSLLRLHQVSPVDSGEYVCRVILGSRPL
EASVLVNIKATSSPAGSIPAPGPVPPVRIESTSPTVAEGQTLDLSCVVAGQTHAQVTWYK
RGGSLPARHQVRGSRLYIFQASPADAGEYVCRASNGMEGSITVTVTRTQGANFAYPPGSS
QPIRIESSSSHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVSPV
DSGEYVCRVVGGSVPLEASVLVTIEPAGSVPALGVTPPVRIESSSSHVAEGQTLDLNCLV
AGQAHAQVTWHKRGGSLPARHQVHGSRLRLPQVTPSDSGEYVCRVVSSSGTQEASVLVSI
QQRHGPSHPQGVVYPVRIESSSASLANGHVLDLNCLVASQAPHTITWYKRGGSLPSRHQI
VGSRLRIPQVTPADSGEYVCHVSNGGGSQETSLIVTIEGSGPSHVPSVSPPIRIESSSPT
VVEGQTLDLNCVVAGQPQATITWYKRGGSLPTQHQAHGSRLRLHHMSVADSGEYVCRANN
NIDAQETSIMVSVSPGAGSPSVPGGAVPIRIESSSSHVAEGQTVDLNCVVPGQAHAQVTW
HKRGGSLPTHHQAHGSRLRLYQVSPADSGEYVCRVGSSSDPLEASVLVNIEASGSSAIPA
PAPGGSQPIRIETSSSHVAEGQTLDLNCVVPGQAHAQVTWHRRGGSLPARHQVHGPLLRL
NQVSPADSGEYSCQVTSSSGTLEASVLVTIEPSSPGPIPAPGLAQPIYIEASSSHVAEGQ
SLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSRLRLHHVSPADSGEYVCRVVGGSGPE
QEASFTVTVLPSAGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIHDGAAPISLEWKTRN
QELEDNVHISPNGSIITIVGTRPSNHGTYRCVASNAYGVAQSVVNLSVHGPPTVSVLPEG
PVRVKVGKSVTLECVSAGEPRSSARWTRIGAPNNVEQRMYGVVDSHTVLQISSAKPSDAG
TYVCLAQNALGTAQKRVEVIVDTGTVAPGAPQVQVEEAELTVEAGHTATLRCSATGSPMP
TIHWSKLRSPLPWQHQLQGDTLIIPRVAQQDSGQYICNATSPAGHAEATIALHVESPPYA
TTVPEHTSVRAGETVQLQCLAHGTPPLTFQWSRVGGSLPARATARNELLRFESVAPEDSG
RYRCQVTNKVGSAEAFAQVFVQGPSGSVLATAIPAGSTPTVQVTPQLETKSIGASVEFHC
AVPSDRGTQLRWIKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYICQAHGPWGQAQASAQL
VVQALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPQVTWSKVGGRLRPGIVQSGGIVR
IAHVELADAGQYRCTATNSAGTTQSHVLLLVQALPQISTPPEVRVPAGSAAAFPCMASGY
PTPDITWSKLDGNLPPDSRLENNMLLLPSVRPQDAGTYVCTATNRQGKVKAFAHLQVPER
VVPYFTQTPHSFLPLPTIKDAYRKFEIKITFRPDSADGLLLYSGMLLYNGQKRSPGSPTN
LANRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGQFHTVTLLRSLTQGSLIVGS
LAPVNGTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSSGFIGCVRELRIQGEEIIFHDL
NLTAHGISHCPTCRDRPCQNGGQCQDSESSSYVCICPAGFTGSRCEHSQALHCHPEACGP
DATCVNRPDGRGYTCRCHLGRSGVRCEEGVTVTTPSMSGTGSYLALPALTNTHHELRLDV
EFKPLAPDGILLFSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRSPEPLALGHWHR
VSAERLNKDGSLRVNGRRPVLRSSPGKSQGLNLHTLLYLGGVEPSVRLPPATNVSAHFHG
CVGEVSVNGKRLDLTYSFLGSRGVGQCYTSSPCERQPCQNGATCMPAGEYEFQCLCLDGF
KGDLCELEENPCQLREPCLHGGTCQGTRCLCPPGFSGLRCQQGTVESDWHLEGSGGNDAP
GQYGAYFHDDGFLALPGRIFSRSVPEVPETIELEVRTSTANGLLLWQGVDMGEAGRGKDF
ISLGLQDGHLVFSYQLGSGEARLVSEDPIDDGEWHRVTALREGRRGSIQVDGEELVSGQS
PGPNVAVNTKGRVYIGGAPDVTTLTGGRFSSGITGCIKNLVLHSARPGAPPPQPLDLQHG
AQAGANTRPCPS
NT seq 13719 nt   +upstreamnt  +downstreamnt
atgggacagcgggcggcgggcgcgctgctgctggcgctgctgctgcacgggcggctgctc
gcggtgacccacgggctgcgggcgtatgatggcttgtctctgcccgaggatgcggagaca
gtcacggtgggccgggctggctggagctactcagacctctctgatgacgaggacttgctg
gcagacgatgcctctggagatggcctggggagcggggacctgggcagtggggactttcag
atggtttatttccgggccctggtaaacttcactcgctccatccactacagtcctcagctg
gaggatgcaggctccgaggagttccgggaggtgtccgaggctgtggtagacacgctcgag
tcggagtacttgaagattcccggagaccaggttgtcagtgtggtgttcatcaaggagctg
gacggctgggtctttgtggagctggatgtgggctctgaggggaacgcggacggggctcag
attcaggaggtgctgcacacagtcatttccagcggctccgtggcctcctacatcacctct
ccccagggattccagttccgtcgcctgggcacagcacagacacccccgccccctccggcc
gccgtggcggccgcagtgacaccagtgccccagttcgcaagagtctgcaccgaggccgag
tttgcctgccacagccacaacgagtgcgtggccctggagtatcgctgtgaccggaggcct
gactgcagggacatgtctgacgagctcaactgtgaggagccagtcccagagctcagctcc
ataccccccgccctggtggagacaccaccaccacccgtagagccccagccggaggcaacc
accacaaggcagctcccaggcagccccactccccagcttctgctccccagtccaagcagg
cctttgccctgtgggcctcacgaggccacctgccacagcggacactgcatccccaaagac
tacatctgtgatgggcaggaggactgtaaggatggcagcgatgagctggactgcggcccc
accccaccctgtgaacccaatgagttcccctgtggaaacgggcactgcgccctcaagctg
tggcactgtgatggggactttgactgtgaggaccgcaccgacgaggtggactgccctgcc
aagcgccccgaggatgtgtgcgggcccacgcagttccgctgtgtctccacgaacacgtgc
atcccggccagcttccactgtgacgaggagagtgactgtcccgaccgcagtgatgaattt
ggctgcatgcccccccaggtggtgacccctccccaggagtccatccaggtttcccggggt
cagacagtgaccttcacctgtgtggccattggcgtccccacccccatcatcaactggagg
cttaactggggccacatcccctctcatcccagggtgacagtgaccagcgaagggggccgt
ggcacactgaccatccgtgacgtgaaggaggcagaccagggtgcctacacctgtgaggcc
atgaatgcccggggcatggtgttcggcattcctgacggtgtcctggagctcattccaaag
cgagggccctgccccgatgggcacttctacctggagcacagcgcctcctgcctgccctgc
ttctgctttggggtcaccaacgtgtgccagagcagccgccgcttccgagaccagatccgg
ctgcgctttgaccagcccgatgacttcaagggggtgaatgtgacgatgcccgcgcagccc
ggcatgccacccctctcctccacccagctgctgatcgaccctgctctgcaggagttccag
ctggtcgacctgtctcgacgcttcctggtgcatgactctttctgggttctgcccgagcag
ttcctgggcaataaggtggattcctacggcggcttcctgcgctacaaggtgcgctatgag
ctggcgcgtggcatgctggagccagtgcagcggccggatgtggttcttgtgggcgccggg
tttcgccttctctcccgagggcacgtgcccacacagcccggcactctgaaccagcgccag
attcagttctctgaggagcactgggtccacgagtctggccggccggtacagcgggctgag
atgttgcaggtgctgcagagcctggaggccgtgctcatccaaaccgtgtacaatgccaag
atggccagcgtgggcctgagcgacattgccatggacaccaccgtcacccacgccaccagc
cacggtcgggcccacagtgtggaggagtgcagatgccccattggctatgccggcttatcc
tgtgagagctgtgatgcccatttcacccgggtgcctggcgggccctacctgggcacctgc
tcgggctgcaactgtaatgggcacgccagctcttgtgaccctgtgtatggccactgcctg
aattgccagcacaacacagaagggccacagtgcaacaaatgcaaggctggcttcttcggg
gacgccacaaaggccacagccactgcctgccggccctgcccttgcccatacattgatgcc
tcccgcagattctcagacacctgcttcctggacacggatggccaggccacatgtgatgca
tgtgccccaggctacacaggccgccgctgtgagagctgtgcccctggatacgagggcaac
cccatccagccaggcgggaagtgcaaacccaccaaccaggagattgtgcgctgtgacgag
cgaggcagtgtggggacctctggggaggcctgccagtgtaagctcccagctctgtgcctg
cagaacaacgtggtggggcgtctgtgcaatgagtgtgtcgccggctctttccacctgagc
actcgtaaccctgatggctgcctcaagtgcttctgcatgggcgtcagtcgccagtgtacc
agctcctcctggagacgtgcccaggtgcagggggcttctgaggagcccgggcagttcagt
ctgaccaacgccgcaggcacccacaccaccagcgagggcatctcatcacccctgcctggg
gagctggtcttctcttccttccacagcctcctgaccggaccctacttctggagcctcccc
tcacgctttcgtggggacaaggtgacctcctatggaggagagctgcgcttcacagtgacc
cagaggccccagcctggctccacgcccctgcacgggcagcccctggttgtactgcagggc
aatggcatcgtcttggagcatcacacttcccaggagcccagccccggccagcccagcacc
ttcaccgtgcccttccgggagcaagcatggcaacggcctgatgggcagccggccacacgg
gagcacctgctgatggccctggcgggcatcgacaccctcctgatccaggcgtccttcagc
cagcggccagccgagagcagggtctctggtatcagcatggacgtggctgtgcctgaggac
accggccaggaccccgcgctggaagtggagcagtgtacctgcccacccgggtaccgtggc
ccatcctgccaggactgtgacacaggctacacacgcatgcccagcggactctacctgggc
acctgtgagcgttgcagctgccatggccacacggaggtctgtgagcctgaaacaggtacc
tgccagggctgccaacaccacacggagggccctcagtgtgagcagtgccagccaggatac
tacggggacgcccagcgggggacgccgcaggactgccagccatgcccatgctatggagcc
cccgctggtggccaggctacccatacttgctttctggacaccgacggccaccccacctgt
gacgcgtgctccccaggccacagcgggcgtcactgtgagaggtgtgccccaggctactat
ggcaaccccagccagggccagccatgccaaagagacggccaactgccagagcctatcggc
tgtggctgtgacccccagggcagcgtcagcagccagtgtgacgccgctggccagtgccac
tgcaaggcccaggtggaaggcctcacgtgcagtcactgccggccccaccacttttacctg
agtgccagcaaccccgacggctgcctgccctgcttctgcatgggcatcacccagcagtgt
gtcagctcctcctacacccgccacctgatctccacccactttgcccccggggacttccaa
ggctttgccctggtgaacccccagcggaacagccgcctgaccggaggcttctcggtggaa
cctgtgcccgagggcgcccagctctcctttagcaacttcgcccaccttggccatgagtcc
ttctactggcagctgccggagccgtaccagggagacaagagggaggcatattttgcacag
atgcgccgggctcacaagaaccgcacgtccctctcagaggagcagttgcggacagctatg
acacctgggaggaccatggggcccccgaagggcaggggccgggcacagcggccatcacag
ctggatgaggcccagaggcggatggatgccgagatctgggagctcctttctagctttgct
gcccacccccacccccccgccggggggctcttatcccgtccacagcctgcagctgctctg
caagcagctccactttcttcctcctcctccttctcttcctcctcctcagcttctgggcct
tcctcagcaggctctcagttctctctctcctacaaaggcttctctcggcttcctgggagc
ctctattattggcagctgccccaagccttcctggggaacaaggtggcggcttatggtggg
aagctgcggtataccctctcctacacagcagcggggcagggcagcccgctctctgaccct
gacgtccagatcacgggcaacaacatcatgctggtggcctcccagccagcgctgcagggc
tctgagaggaagagctttgagatcattttccgagaggaattctggcgccggcctgatggg
cagccggccacccgtgagcacctcctgatggcgctggctgacctggatgagctcctggtc
cgggccacgttctcctcgatgcccctggcaaccagcatcaactcagtcagcctggaagtc
gcccagccggggccctcggagggaccccgggccctggaggtggaggagtgtcggtgtcct
ccgggctacattggcttatcctgccaggactgcgccccgggctacacgcggactggcagt
gggctctacctcggacactgtgagctgtgtgaatgcaacggccactcagacgtgtgccac
ccagagacgggggcctgttcgcagtgccagcacaacgccgctggggagttctgtgagctc
tgtgcacctggctactatggagatgccacagctgggacacctgaggactgccagccctgt
gcctgcccactgaccaacccggagaacatgttctcccgcacctgtgagagcctgggggct
ggtgggtatcgctgcacagcctgcgaacttggctacgctggccagtactgtgagcagtgt
gcccccggttacgtgggtaaccccagtgtgcgggggggccgatgcctgccacaggcagat
gcagccccgctggtggtccaggtgcatccagctcggagcatagtaccccaaggtggctcc
cactccctgcggtgccaggtcagtgggagcccacctcactacttttactggtctcgtgag
gatgggcgtcccgtgccaggcagcacccagcagcgacaccaaggctctgagctccacttc
cccagcgtccagccctcagatgccggcgtctacatctgcacctgtcgtaacctccatcac
gccaataccagccgggccgagctgctggtcactgaagctccgagcaagcccatcacagtg
acagtggaggagcagcggagccagagcgtgcgccccggagccgacgtcaccttcatctgc
acagccaagagcaagtctccggcctacaccctggtttggacccgcctgcacaacgggaaa
ctgccaacccgggccatggacttcaacggcatcctgaccattcggaacgtgcagccgagt
gacgcgggcacctacgtgtgcactggctccaacatgtttgccatggaccagggcacagcc
acgctgcatgtgcaagcctcgggcaccccatcggcccccgtggtctccatccatccgccg
cagctcaccgtgcagcccgggcagctggccgagttccgctgcagcgccacagggagcccc
gcacccaccctccagtggacagggggccccggtggccagatccctcagaaggcccagatc
cacggcggcatcctgcgtctgccaaacatcgagccctcggatcaggcccagtacctgtgt
cgtgcccataacagcgccgggcagcacgtggccagggccgtgctccacgtgcatgggggc
agcgggcccagggtccaggtgagcccagagaggactcaggttcacgaaggccgcaccgtg
aggctgtactgcagggccgcaggtgtgcccagcaccaccatcacctggaggaaggagggg
ggcagcctccccccgcaggcccggtccgagcgcgccgagatcgccacgctgctcatcccg
gccatcacggccgccgacgccggcttctacctctgcgtggccaccagccccgcgggcacc
gcacaggccaggatccaagtggttgtgcttccagcttcaggcgccagctccccgccagtc
agaatcgagtcttcctcacccaccgtgaccgaaggccagaccctggacctcaactgtgtg
gtggcagggctggcccacacctccatcacctggtacaagcgaggaggcagcctgcccccc
cacagccaggtgcacggctcccggttacggcttccccaggtctcaccagctgattctgga
gaatacgtatgccgagtggagaacgaggcaggcgccaaggaggcctccatcatcgtctct
gtcttccacagcacccactcgggctctagctacaccctagctccggagggagccccagct
ccgggcggctcccagcccatccgcatcgagtcctcctcctcccacgtggccgaggggcag
accctggacctgaactgtgtggtgcccgggcaggcacacgcccaggtcatgtggcacagg
cgcgggggcagcctccccgcccggcaccagacccacggctcgctgctgcggctgcaccag
gtgtccccggtcgactcgggcgagtatgtgtgccgcgtgatccttggctctaggcccctg
gaggcctctgtcctggtcaacatcaaggccaccagctcccctgcgggctccatccctgcc
ccaggacctgtcccacctgtcaggatcgagtccacatcccccacggtggccgaggggcag
accctggatctgagctgtgtggtggcagggcagacccacgcccaggtcacgtggtacaag
cgcgggggcagcctccccgcccggcaccaggtccgcggctcccgcctgtacatcttccag
gcctcgccagccgacgcaggcgagtatgtttgccgggccagcaacgggatggagggctcc
atcacagtcacagtaaccaggacccagggggccaacttcgcctaccctccgggtagctcc
cagcccatccgcatcgagtcctcctcctcccacgtggccgaaggacagaccctggacctg
aactgcgtggtgcccggccaggcccacgcccaggtcacgtggcacaagcgcgggggcagc
cttcccgcccgacaccagacccacggctcactgctgagactacaccaggtgtccccagtt
gactcgggcgagtatgtgtgccgcgtggtgggtggctcggtgcccctggaggcctctgtc
ctggtgaccattgagcctgcaggctctgtacccgcgttgggggtcaccccccctgtccgg
atcgaatcatcgtcctcccacgtggcggaagggcagactctggatctgaactgcctggtt
gctgggcaggcccacgcccaggtcacgtggcacaaacgcgggggcagcctccccgcccgg
caccaggtgcacggctccaggctgcgcctgccccaggtgaccccctccgactctggggag
tacgtgtgtcgcgtggtgagcagctcggggacgcaagaagcctccgtcctggtcagcatc
cagcagcgccatggcccctcccacccccagggtgtggtgtaccccgtccgcatcgagtcc
tcctcggcctccctggccaatggacatgtcctggacctcaactgcctggtggccagccaa
gccccgcacaccatcacctggtacaagcgtggaggcagccttcccagccggcaccagatc
gtgggctcccgactccggatcccccaggtgacgccggccgactcgggtgaatatgtgtgt
cacgtcagtaacggtggcggctcccaggagacctcactcattgttaccatcgagggcagt
ggcccctcccacgtgcccagcgtctccccccccatccggatcgagtcctcgtcccccacg
gtggtcgaagggcagaccctggatctgaactgtgtggtggctgggcagccccaggccacc
atcacgtggtacaagcgtggcggcagccttcccacccaacaccaggcccacggctcccgc
ctgcggctgcaccacatgtctgtggctgactcgggcgagtacgtgtgccgtgccaacaac
aacatcgatgcccaggagacctccatcatggtctccgtctcccccggcgccggcagcccc
tccgtccccggtggtgctgtacccatcagaattgagtcctcctcctcccatgtggccgaa
gggcagaccgtggacctgaactgtgtggtgcccgggcaggcccacgcccaggtcacgtgg
cacaagcgcgggggcagcctccccactcaccaccaggcccacggctctcggctgcggctg
taccaggtgtccccggctgactcgggcgagtacgtgtgccgcgtggggagcagctcagac
cccctggaggcctcagtcctggtcaacatcgaggcctctggctccagcgctattcctgct
cctgccccaggtggctcccagcccatccgcatcgagacctcttcctcccacgtagccgag
gggcagaccctggatctgaactgtgtggtccctggacaggcccacgcccaggtcacatgg
cacaggcgcgggggcagccttcctgcccggcaccaggtccacggacccctgctgaggctg
aatcaggtgtccccggctgactctggagagtactcatgccaagtgaccagcagctcaggc
accctggaggcttctgtccttgtcacaattgagccgtccagcccaggccccattcctgct
ccaggactggcccagcccatctacatcgaggcctcctcctcccatgtggccgaaggacag
agcctggacctgaactgcgtggtgcccgggcaggcccacgcccaggtcacatggtacaag
cgtgggggcagcctccctgcccggcaccagacccacggctcccggctgaggctgcaccac
gtctccccagctgactcgggcgagtacgtgtgccgtgtggttggaggctcgggccctgag
caggaggcttcctttacagtcactgtcctgcccagtgcggggtcctcctaccgcctcagg
agccccgtcatctctatcgacccacccagcagcaccgtgcagcagggccaagatgccagc
ttcaagtgcctcatccatgacggggcagcccccatcagcctcgagtggaagactcggaac
caagaactggaggacaatgttcacatcagccccaacggctccatcatcaccatcgtgggc
acccggcccagcaaccacgggacttaccgctgcgtggcctccaacgcctatggtgtggcc
cagagtgtcgtgaacctcagcgtgcacggaccccccactgtgtctgtgctccccgagggc
cccgtgcgggtgaaagtgggcaagtccgtcaccctggagtgtgtcagtgctggggagccc
cgctcttcagctcgctggactcggatcggcgcccccaacaatgtggagcagcggatgtat
ggggtcgtggacagccacacggtgttgcagatctcatcagctaaaccatcagatgcaggc
acctacgtatgcctcgctcagaatgcactgggcacagcacagaagcgggtggaggtgatt
gtggacacgggcactgtggccccaggggcgccccaggtccaagttgaagaagccgagctg
accgtagaggctggacacacagccaccctgcgctgctcagccacaggcagccccatgccc
accatccactggtccaagctgcgttccccgctgccctggcagcaccagctgcaaggtgac
acactgatcatcccccgagtagcccagcaggactcgggccagtacatctgcaatgccact
agccctgccgggcacgctgaggccaccatcgccctgcacgtagagagcccaccgtatgcc
accacagtcccggagcacacttcggtgcgggcaggggagacagtgcagctccagtgcctg
gctcatgggacacccccgctcaccttccagtggagccgtgtgggtggcagcctccctgca
agggcaaccgccaggaacgagctgctgcgctttgagtccgtggcccctgaggactcgggc
cgctaccgttgccaggtcaccaacaaggtgggctcggcagaggccttcgcccaggtgttt
gttcaaggcccctctggctctgtcctggcaactgccatcccagcaggatccacgcccacc
gttcaggtcacacctcagctggagaccaagagcataggggccagcgtcgagttccactgt
gctgtgcccagtgaccggggcacccagctccgctggatcaaggaagggggtcagctgcct
cctggccacagtgtgcaggatggggtgctccgaatccagaacttggaccagagttgccaa
gggacatatatttgccaggcccatggaccgtggggacaggcccaggccagtgcccaactg
gttgtccaagccctgccctcggtgctcatcaacatccggacctccgtgcagaccgtggtg
gtcggccatgccgtggagttcgagtgcctggccctgggtgaccccaagcctcaagtgaca
tggagcaaagttgggggacgcctgcggcccggcatcgtgcagagcggaggcattgtcagg
atcgcccacgtggagctggccgatgcaggacagtatcgctgcaccgccaccaactctgcc
ggcaccacccagtcccacgtgctgctgctcgtgcaagccttgccccagatctcaacaccc
ccagaggtccgtgtgcctgctggttctgcagccgccttcccctgcatggcctctggctac
ccgactcctgacatcacctggagcaagctggacggcaacctgccacccgacagccgcctg
gaaaacaacatgctgctgctgccctctgtccggcctcaggacgccggcacctatgtctgc
accgccactaaccgccagggcaaggtcaaagccttcgcccatctgcaggtgccggagcgg
gtggtcccctacttcacgcagaccccgcactccttcctgccgctgcccaccatcaaagat
gcctataggaagttcgagatcaagatcaccttccggcctgactcagctgatggcctcctt
ctctactcggggatgctgctgtacaacgggcagaagcggagcccggggagccccaccaac
ctggccaacaggcagcctgacttcatctccttcggcctcgtggggggcaggcctgagttc
cggtttgacgcaggctcaggcatggccaccatccgccaccccacaccgctggcgctgggc
cagttccacaccgtgaccctgctgcgcagccttacccagggctccctgattgtgggcagc
ctggcccccgtcaacgggacctctcagggcaagttccagggcctggacctaaatgaggag
ctctacctgggtggctaccccgactacggtgccatccccaaggccgggctgagcagcggc
ttcataggctgcgtccgggagctacgcatccagggcgaggagatcatcttccacgacctc
aacctgaccgcccacggcatctcccactgccccacctgtagggaccggccgtgccagaac
gggggccaatgtcaggattcagagagcagcagctacgtgtgcatctgcccggctggcttc
accgggagtcgctgtgagcactcgcaggccctgcactgccacccagaggcctgtgggccc
gatgccacctgcgtgaaccgacctgatggccgaggctacacttgccgctgccacctgggc
cgctcaggggtgaggtgtgaggaaggtgtgacggtgaccaccccctccatgtcgggcacc
ggctcctacctggcactgcccgccctcaccaacacacaccacgagctgcgcctggacgtt
gagttcaagccgctggcacccgacggcatcctgctgttcagcggggggaagagtgggccc
gtggaggacttcgtgtccctggcaatggtcggcggccacctggagttccgctacgagtta
gggtcagggctggctgtgctgcggagccccgagccgctggccctgggccactggcaccga
gtgtcggcggagcgtctgaacaaggacggcagcttgcgcgtgaacggcagacgcccggtg
ctgcgctcctcgcccggcaagagccagggcctcaacctgcacaccctcctctacctcggg
ggcgtggagccctccgtgcggctgcccccggccaccaacgtcagcgctcacttccacggc
tgtgtgggcgaggtgtctgtgaacgggaagcggctggacctcacctacagcttcctgggc
agccggggcgtcggccagtgctacaccagctccccgtgcgagcgccagccttgccagaac
ggcgccacgtgcatgcctgccggcgagtacgagttccagtgcctgtgtctcgatggcttc
aaaggagacctctgtgagctcgaggagaacccctgccagctccgtgagccctgcctgcat
gggggcacctgccagggcacccgctgcctctgtccccccggcttctctggcctgcgctgc
caacaaggcacagtggagtctgactggcatctggaaggcagtgggggcaatgatgcccct
gggcagtacggagcctatttccacgacgatggcttcctagctctcccaggccgcatcttc
tccaggagtgtgcctgaggtgccggagaccatcgagctggaggttcggaccagcacggcc
aacggcctcctgctctggcagggcgtggacatgggcgaggccggccgtggcaaggacttc
atcagtcttgggcttcaggacgggcacctggtcttcagctaccagctgggcagtggggag
gcccgccttgtctctgaggaccccattgacgatggcgagtggcatcgggtgactgcgctg
cgagagggccggagaggctccatccaggtggacggcgaggagctggtcagcggccagtcc
ccaggccctaacgtggcagtcaacaccaagggccgcgtctacatcggcggagctcccgac
gtgaccacgctgaccgggggcaggttctcctcgggcatcacgggctgtatcaagaatctg
gtgctgcactccgcccggcccggcgccccgcccccgcagccgctggacctgcagcacggc
gcccaggcgggagccaacactcgcccctgcccctcgtag

DBGET integrated database retrieval system