KEGG   Canis lupus familiaris (dog): 403480
Entry
403480            CDS       T01007                                 

Gene name
ATP2B1
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04020  Calcium signaling pathway
cfa04022  cGMP-PKG signaling pathway
cfa04024  cAMP signaling pathway
cfa04261  Adrenergic signaling in cardiomyocytes
cfa04925  Aldosterone synthesis and secretion
cfa04961  Endocrine and other factor-regulated calcium reabsorption
cfa04970  Salivary secretion
cfa04972  Pancreatic secretion
cfa04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    403480 (ATP2B1)
   04024 cAMP signaling pathway
    403480 (ATP2B1)
   04022 cGMP-PKG signaling pathway
    403480 (ATP2B1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    403480 (ATP2B1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    403480 (ATP2B1)
  09154 Digestive system
   04970 Salivary secretion
    403480 (ATP2B1)
   04972 Pancreatic secretion
    403480 (ATP2B1)
   04978 Mineral absorption
    403480 (ATP2B1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    403480 (ATP2B1)
Enzymes [BR:cfa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     403480 (ATP2B1)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3 DUF2201_N
Other DBs
NCBI-GeneID: 403480
NCBI-ProteinID: NP_001184013
Ensembl: ENSCAFG00000006121
VGNC: 38256
UniProt: J9P4S0
Position
15
AA seq 1220 aa
MGDMANNSLAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVSGIC
SRLKTSPNEGLSGNPADIERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK
KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
TMNRMTVVQAYINEKHYKKIPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFS
KGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEP
EPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIAT
KCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVSEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQ
IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQIRVVNAFRSSLYEGLEKPESRSS
IHNFMTHPEFRIEDSEPHIPLIDDTDAEDDAPTKRNSSPPPSPNKNNNAVDSGIHLTIEM
NKSATSSSPGSPLHSLETSL
NT seq 3663 nt   +upstreamnt  +downstreamnt
atgggcgacatggcaaacaactcacttgcatatagtggagtaaaaaactctttgaaggaa
gctaatcatgacggagactttggaatcacgctcgcagagctgcgggctctcatggagctc
aggtctacagatgcattacgaaaaatacaagaaagctatggagacgtctctggaatttgc
agcaggttgaaaacatctcccaatgaaggtttaagtggaaaccctgcagatatagagaga
agagaagcggtgtttggaaagaattttatacctcctaaaaagccaaaaacctttcttcaa
ttagtatgggaagcattacaagatgtcactttaattatactagaaattgcagccatagta
tcattgggcctttctttttatcaacctccagaaggggataatgcactttgtggagaagtt
tctgttggagaggaagaaggtgaaggtgaaactggttggattgaaggagctgcaatcctc
ttgtcagtagtgtgtgtggtattagtaacagctttcaatgactggagtaaggaaaaacag
tttagaggtttgcagagtcgaattgaacaagaacagaagttcacagtcatcaggggtggt
caggtcattcagatacctgtagctgacattactgttggagatattgctcaggtgaaatat
ggtgatcttcttccagccgatggcatattgattcagggcaatgatcttaaaattgatgaa
agctcattgactggtgaatctgatcatgttaagaagtctttagataaggatcccttactt
ctatcaggtactcatgtaatggaaggctctggaagaatggtcgttactgctgtaggtgtt
aattctcaaactggaattatctttaccttacttggagctggaggtgaagaggaagaaaag
aaggatgaaaagaaaaaggaaaagaaaaataagaaacaagatggagctattgagaatcgc
aataaagcaaaagcccaggatggtgcagccatggaaatgcagcctttgaagagtgaagaa
ggtggagatggtgatgaaaaagacaaaaagaaagcaaatttgccaaaaaaggaaaaatct
gtcttacaagggaaacttacaaagctggctgttcagattggcaaagcaggtttgttgatg
tctgccatcacagttatcattctggtattatattttgtaattgatacattctgggttcag
aagagaccatggcttgctgagtgcacaccaatttacatacaatattttgtgaagttcttc
attattggagttacagttctagtggttgcggtaccagaaggtcttccccttgcggtcact
atctcgctggcgtattcagtcaagaaaatgatgaaagataataacttagtaaggcatctg
gacgcttgtgaaaccatgggaaatgctacagctatttgctcagataaaacagggacattg
acaatgaacagaatgactgttgttcaagcttacataaatgaaaaacactataaaaagatt
cctgaaccagaagctattccaccaaatattttgtcctatcttgtaacaggaatttctgtg
aattgtgcttatacatcaaaaatattgccaccagagaaagagggtggattacctcgtcat
gttggtaataaaactgaatgtgccttgttgggacttcttttggatttaaaacgagattat
caggatgttagaaatgaaataccagaagaagcactgtacaaagtctacaccttcaattct
gttaggaagtccatgagtactgtcctgaaaaattcagatggaagttatcgaatattcagc
aagggtgcatctgagataattctgaaaaagtgtttcaaaatcttgagtgctaatggtgag
gcaaaagtattcagaccaagggaccgtgatgatattgtaaaaacagtgattgaaccgatg
gcatcagaaggcttgagaaccatatgtcttgcattcagagatttcccagcaggagaacct
gaaccagagtgggataatgaaaatgatattgtcaccggccttacgtgcattgctgttgtg
gggattgaagaccctgtgagacctgaggtaccagatgcaataaagaaatgtcagagggct
ggaattactgtgcggatggtcaccggtgataatattaatactgcacgggcgattgctacc
aaatgtggtattttacatcccggggaagattttctatgcctagaaggtaaagatttcaac
cgaagaatacgaaatgaaaaaggagagattgagcaagagcggatagacaagatttggcca
aagcttcgagtacttgcaagatcatctcctactgacaaacatacactggttaaaggtata
attgacagcactgtgtcagaacaacgccaggttgtagctgtaactggtgatggtacaaat
gatggcccagccctaaagaaagctgatgttggatttgcaatgggtattgctggaactgat
gtagctaaagaagcatctgatattattctcacagacgacaactttacaagcattgttaag
gcagttatgtggggacgaaatgtgtatgacagcatctcaaaatttcttcagttccagctc
actgttaacgtggtagccgtgatagttgctttcacgggcgcctgtattactcaagattca
ccgcttaaggctgtgcagatgctgtgggtaaacctcataatggatacgctcgcttccctg
gctctggcaactgaaccccccactgaatctctcttgcttcggaagccttatggtagaaat
aagcctctcatctcacgcacgatgatgaagaatattttgggtcatgcattctatcaactt
gtagtagtctttacactcttatttgctggagaaaagtttttcgatattgatagtggaaga
aatgctcctttgcatgctcctccttcagaacattatactattgtttttaatacctttgtg
ctgatgcaacttttcaacgaaataaatgcccggaaaattcatggtgaaagaaatgtgttc
gaaggaatctttaataatgccatcttctgcacaattgttttaggcacttttgtggtacag
ataataattgtgcagtttggtggaaaacctttcagttgttcagaactttcaatagaacag
tggctatggtcaatattcctaggaatggggacattactctggggccagcttatttcaaca
attccaactagccgtttaaaattcctaaaagaagctggccatggaacacaaaaggaagaa
atcccagaggaggagctcgcagaggatgtggaagagattgaccatgctgaaagggaactg
cggcgtggccagatcttatggtttagaggtctgaacagaatccaaactcagattcgagtg
gtgaatgcatttcgtagttctttatatgaagggttagaaaaaccggaatcaagaagttcg
attcacaactttatgacacatcctgagtttaggatagaagattcagagcctcatatcccc
ctaattgatgacactgatgctgaagatgatgctcctacaaaacgtaactccagtcctcca
ccctctcccaacaaaaataacaatgctgttgacagcgggattcaccttacaatagaaatg
aacaagtctgctacctcttcatccccaggaagcccactacatagtttggaaacatcactc
tga

DBGET integrated database retrieval system