KEGG   Canis familiaris (dog): 403511
Entry
403511            CDS       T01007                                 

Gene name
GNB3
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
  KO
K07825  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04014  Ras signaling pathway
cfa04062  Chemokine signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04371  Apelin signaling pathway
cfa04713  Circadian entrainment
cfa04723  Retrograde endocannabinoid signaling
cfa04724  Glutamatergic synapse
cfa04725  Cholinergic synapse
cfa04726  Serotonergic synapse
cfa04727  GABAergic synapse
cfa04728  Dopaminergic synapse
cfa04742  Taste transduction
cfa04926  Relaxin signaling pathway
cfa05032  Morphine addiction
cfa05034  Alcoholism
cfa05163  Human cytomegalovirus infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05170  Human immunodeficiency virus 1 infection
cfa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    403511 (GNB3)
   04371 Apelin signaling pathway
    403511 (GNB3)
   04151 PI3K-Akt signaling pathway
    403511 (GNB3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    403511 (GNB3)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    403511 (GNB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    403511 (GNB3)
   04727 GABAergic synapse
    403511 (GNB3)
   04725 Cholinergic synapse
    403511 (GNB3)
   04728 Dopaminergic synapse
    403511 (GNB3)
   04726 Serotonergic synapse
    403511 (GNB3)
   04723 Retrograde endocannabinoid signaling
    403511 (GNB3)
  09157 Sensory system
   04742 Taste transduction
    403511 (GNB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    403511 (GNB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    403511 (GNB3)
  09165 Substance dependence
   05032 Morphine addiction
    403511 (GNB3)
   05034 Alcoholism
    403511 (GNB3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    403511 (GNB3)
   05163 Human cytomegalovirus infection
    403511 (GNB3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    403511 (GNB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    403511 (GNB3)
   04031 GTP-binding proteins [BR:cfa04031]
    403511 (GNB3)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   403511 (GNB3)
GTP-binding proteins [BR:cfa04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    403511 (GNB3)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A WD40_like Cytochrom_D1 CALM_bind
Other DBs
NCBI-GeneID: 403511
NCBI-ProteinID: NP_001003004
Ensembl: ENSCAFG00000014655
VGNC: 41314
UniProt: P79147 A9UHL9
Position
27
AA seq 340 aa
MGEMEQLRQEAEQLKKQIADARKACADTTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYA
MHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNM
CSIYSLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVF
VGHTGDCMSLAVSPDFKLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEA
ICTGSDDASCRLFDLRADQELTAYSDESIICGITSVAFSLSGRLLFAGYDDFNCNIWDSM
KGERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKVWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgggggagatggagcagctacggcaggaagcagagcagctcaagaagcagattgcagat
gccaggaaagcctgtgctgacactactctggcagagctggtgtcaggcctagaggttgta
ggaagagtccagatgcggacacggcggacgttaaggggacacctagccaagatctatgcc
atgcactgggccaccgattccaagctgctggtaagtgcctcgcaagatgggaagctgatc
gtgtgggacacctataccaccaataaggtgcatgctatcccactgcgctcctcttgggtc
atgacctgtgcctatgcaccatcagggaactttgtggcatgcggggggctggacaacatg
tgctccatctacagcctcaaatcccgtgagggtaatgtcaaggtcagccgggagctgtct
gctcacacaggatatctctcctgctgccgcttcctggatgacaacaacattgtgaccagt
tctggagacaccacttgtgctctgtgggatatcgagaccgggcagcaaaagacggtgttt
gtgggacacacgggggattgcatgagtctggctgtgtctcctgacttcaaactcttcatt
tcgggggcctgtgacgccagcgccaagctctgggatgtgcgggaggggacctgccggcag
actttcactggccatgagtccgacatcaatgctatctgttttttccccaacggagaggcc
atctgcacaggctcggacgacgcctcctgccgcctgtttgacctgcgggctgaccaggag
ctgactgcctactccgacgagagcatcatctgtggcatcacatctgtggccttctccctc
agcggccgcctgctctttgcaggctacgacgacttcaattgcaacatctgggactccatg
aagggcgagcgtgtgggcatcctctctggccatgacaacagggtcagctgcctaggggtc
acagctgatgggatggctgtggccactggctcctgggacagcttcctcaaagtctggaac
taa

DBGET integrated database retrieval system