KEGG   Canis familiaris (dog): 403784Help
Entry
403784            CDS       T01007                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00220  Arginine biosynthesis
cfa00330  Arginine and proline metabolism
cfa01100  Metabolic pathways
cfa04020  Calcium signaling pathway
cfa04022  cGMP-PKG signaling pathway
cfa04066  HIF-1 signaling pathway
cfa04071  Sphingolipid signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04370  VEGF signaling pathway
cfa04371  Apelin signaling pathway
cfa04611  Platelet activation
cfa04915  Estrogen signaling pathway
cfa04921  Oxytocin signaling pathway
cfa04926  Relaxin signaling pathway
cfa04931  Insulin resistance
cfa04933  AGE-RAGE signaling pathway in diabetic complications
cfa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    403784 (NOS3)
   00330 Arginine and proline metabolism
    403784 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    403784 (NOS3)
   04371 Apelin signaling pathway
    403784 (NOS3)
   04066 HIF-1 signaling pathway
    403784 (NOS3)
   04020 Calcium signaling pathway
    403784 (NOS3)
   04071 Sphingolipid signaling pathway
    403784 (NOS3)
   04022 cGMP-PKG signaling pathway
    403784 (NOS3)
   04151 PI3K-Akt signaling pathway
    403784 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    403784 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    403784 (NOS3)
   04921 Oxytocin signaling pathway
    403784 (NOS3)
   04926 Relaxin signaling pathway
    403784 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    403784 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    403784 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    403784 (NOS3)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     403784 (NOS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Motif
Other DBs
NCBI-GeneID: 403784
NCBI-ProteinID: NP_001003158
Ensembl: ENSCAFG00000004687
VGNC: 43896
UniProt: F1PV06
Position
16
AA seq 1205 aa AA seqDB search
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPTSEPSRAPALAPPPSPPPAPDHSSPP
LTRPPDGPKFPRVKNWEVGSITYDTLSAQSQQDGPCTPRRCLGSLVFPRKLQSRPSQNPA
PPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAW
RNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRASGR
GDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDE
PPELFALPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYM
STEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIV
DHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYVLSPAFRYQTD
PWKGSASKGAGVTRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQL
GRLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYN
SSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYP
HFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKA
AARDIFSPKRTWKRQRYRLSAQAEGLQLLPGLIHVHRRKMVQATVLAVENLQSSKSTRAT
ILVRLDTGSQEALQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPGEPVAVEQLEKGSPG
GPPPSWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEESSEQQELESLSQDPR
RYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSAHPGEIHLTVA
VLAYRTQDGLGPLHYGVCSTWLSQLKAGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGI
APFRGFWQERLHDIDSKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVFGRVLTAFS
REPDSPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDME
LDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWALDPPGP
DTAGP
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggagcccgggcccccttgtggcctggggctgggc
ctgggcctggggctatgtggcaagcagggccctgcctccccgacctcagagcccagccgg
gcaccggccctggcgcccccaccctcgcccccaccagcaccagaccacagcagcccccca
ctcacccggcctccagatgggcccaagttccctcgtgtgaagaactgggaggtggggagc
atcacctatgacaccttgagtgcccagtcacagcaggatgggccctgcaccccaagacgc
tgtctaggctctctggtatttccacggaaactacagagccggccctcccagaaccctgca
ccccctgagcagctgctgagccaggccagggacttcatcaaccagtactacagctccatc
aagaggagtggctcccaggcccatgagcagaggcttcaagaggtggaagctgaggtagca
gccacaggcacctatcagcttcgggaaagcgagctggtgttcggggccaagcaggcctgg
cgaaacgctcctcgctgcgtgggccggatccagtgggggaagctgcaggtgtttgatgcc
cgggattgcagctctgcccaggagatgttcacctacatctgcaaccacatcaagtatgcc
accaaccggggcaacctccgctcggccatcacagtgttcccccagcgtgcctcaggccgc
ggagactttcgaatttggaacagccagctggtgcgctatgcgggctacaggcagcaggat
ggctctgtgcggggggacccagccaacgtggagatcactgagctctgcatccagcatggc
tggactccaggaaacggccgctttgatgtgctgcccctactgctccaggccccagatgaa
cccccagaactctttgctctgccccccgagctggttctcgaggtgcccctggagcacccc
acgctggagtggtttgcggccctgggcctgcgctggtatgccctcccagcggtgagcaac
atgctgctggaaattggggggctggagttccctgcggcccccttcagcggctggtacatg
agcactgagattggcacgcggaacctgtgtgaccctcatcgatacaacatcctggaggat
gtggctgtctgcatggacttggataccaggaccacctcatccctgtggaaagacaaggca
gcagtggaaatcaacttggctgtgctgcacagttaccagctggccaaagtgaccatcgtg
gaccaccatgctgccacagcctccttcatgaagcacctggagaacgagcagaaggccagg
gggggttgccctgctgactgggcctggatcgtgccccccatctctggcagcctcacccct
gttttccatcaggagatggtcaactatgtcctgtccccggccttccgctatcagacagac
ccgtggaaggggagtgcatccaagggtgccggcgtcaccaggaagaaaacctttaaggaa
gtggccaatgcggtgaagatctctgcctcactcatgggcactgtgatggcaaagcgagtg
aaggcgacaatcctctatggctccgagactggccgggcccagagctatgcacagcagctg
gggagactcttccggaaggctttcgacccccgggtcctgtgcatggatgagtatgacgtg
gtgtcccttgagcatgagacgctggtgttggtggtgaccagcacatttgggaatggtgat
cccccagagaatggagagagttttgcggcagccctgatggagatgtcgggtccctacaac
agctcccctcggccagaacagcacaagagttacaaaatccgcttcaacagtgtctcctgc
tcagacccactggtgtcctcctggaggcggaagagaaaggagtccagtaacacagacagt
gctggggcactgggtaccctcaggttctgtgtgttcgggctgggctcccgggcatacccc
cacttttgtgcctttgctcgtgcggtggacacacggctggaagagctgggtggggagcgg
ctgctgcagctgggccaaggagatgagctgtgtggccaggaggaggccttccgaggctgg
gcccaggccgccttccaggcctcctgtgagaccttctgcgtgggagaggatgccaaggct
gccgcccgggacatattcagccccaaacggacctggaaacgccagaggtaccggctgagc
gcccaggctgagggcctccagctgctgccaggactgatccatgtgcacaggaggaagatg
gtccaggctactgtcctcgcagtggaaaacctgcaaagcagcaagtccacccgggccaca
atcctggtgcgcctggacactggaagccaggaggcgctgcagtaccagccaggggaccac
attggcatctgcccgcccaaccggcctggccttgtggaggcgctgctgagccgggtggag
gatccaccgccaccaggagagccagtggcagtggagcagctggagaagggcagccccggt
ggcccaccccccagctgggttcgggaccctcgcctgcccccatgcacactgcgccaggct
ctcaccttcttcctggacatcacttccccgcccagccctcaactccttcgactgctcagc
accctggctgaagagtccagtgaacagcaggagcttgagagcctcagccaggacccccgg
cgctatgaggaatggaagtggttccgctgccccacactgctggaggtactggaacagttc
ccatcggtggcactgcccgcccccctgctcctcacccagctgcccctgctccagccccgg
tactactcggtcagctcagcacccagtgcccacccaggagagatccacctcacagtagct
gtgctggcatacaggacacaggatggactgggcccccttcattatggagtctgctccaca
tggctaagccaacttaaggccggagatcctgtaccctgcttcatcaggggggctccctcc
ttccggctgccacctgatcccagtctgccttgcatcttagtgggtcctggtacgggtatt
gccccctttcggggtttctggcaggagcggctgcacgacattgacagcaaagggctgcag
cccgcccccatgactctggtgttcggctgccgatgctcccagctcgaccacctttaccgc
gacgaggtgcaggatgcccagcagcgcggagtttttgggcgcgtcctcaccgccttctcg
cgggagcccgacagccctaagacgtacgtgcaggacatcctgcggacggagctggctgct
gaggtgcaccgcgtgctgtgcctcgagcggggccacatgtttgtgtgcggcgacgtcacc
atggcaaccagcgtcctgcagacggtgcagcgaatcctggcgacggagggcgacatggag
ctggacgaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggac
attttcgggctcacactgcgcacccaggaggtgacaagccgcatacgcacccagagcttc
tccttgcaggagcggcatctgcggggcgcggtgccctgggcgttggacccgcccggccca
gacaccgccggcccctga

DBGET integrated database retrieval system