KEGG   Canis lupus familiaris (dog): 442859
Entry
442859            CDS       T01007                                 

Symbol
NFKB1
Name
(RefSeq) nuclear factor NF-kappa-B p105 subunit
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa01523  Antifolate resistance
cfa04010  MAPK signaling pathway
cfa04014  Ras signaling pathway
cfa04024  cAMP signaling pathway
cfa04062  Chemokine signaling pathway
cfa04064  NF-kappa B signaling pathway
cfa04066  HIF-1 signaling pathway
cfa04071  Sphingolipid signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04210  Apoptosis
cfa04211  Longevity regulating pathway
cfa04218  Cellular senescence
cfa04380  Osteoclast differentiation
cfa04613  Neutrophil extracellular trap formation
cfa04620  Toll-like receptor signaling pathway
cfa04621  NOD-like receptor signaling pathway
cfa04622  RIG-I-like receptor signaling pathway
cfa04623  Cytosolic DNA-sensing pathway
cfa04625  C-type lectin receptor signaling pathway
cfa04657  IL-17 signaling pathway
cfa04658  Th1 and Th2 cell differentiation
cfa04659  Th17 cell differentiation
cfa04660  T cell receptor signaling pathway
cfa04662  B cell receptor signaling pathway
cfa04668  TNF signaling pathway
cfa04722  Neurotrophin signaling pathway
cfa04917  Prolactin signaling pathway
cfa04920  Adipocytokine signaling pathway
cfa04926  Relaxin signaling pathway
cfa04931  Insulin resistance
cfa04932  Non-alcoholic fatty liver disease
cfa04933  AGE-RAGE signaling pathway in diabetic complications
cfa04936  Alcoholic liver disease
cfa05010  Alzheimer disease
cfa05022  Pathways of neurodegeneration - multiple diseases
cfa05030  Cocaine addiction
cfa05132  Salmonella infection
cfa05133  Pertussis
cfa05134  Legionellosis
cfa05135  Yersinia infection
cfa05140  Leishmaniasis
cfa05142  Chagas disease
cfa05145  Toxoplasmosis
cfa05146  Amoebiasis
cfa05152  Tuberculosis
cfa05160  Hepatitis C
cfa05161  Hepatitis B
cfa05162  Measles
cfa05163  Human cytomegalovirus infection
cfa05164  Influenza A
cfa05165  Human papillomavirus infection
cfa05166  Human T-cell leukemia virus 1 infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05168  Herpes simplex virus 1 infection
cfa05169  Epstein-Barr virus infection
cfa05170  Human immunodeficiency virus 1 infection
cfa05171  Coronavirus disease - COVID-19
cfa05200  Pathways in cancer
cfa05202  Transcriptional misregulation in cancer
cfa05203  Viral carcinogenesis
cfa05206  MicroRNAs in cancer
cfa05207  Chemical carcinogenesis - receptor activation
cfa05208  Chemical carcinogenesis - reactive oxygen species
cfa05212  Pancreatic cancer
cfa05215  Prostate cancer
cfa05220  Chronic myeloid leukemia
cfa05221  Acute myeloid leukemia
cfa05222  Small cell lung cancer
cfa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfa05321  Inflammatory bowel disease
cfa05415  Diabetic cardiomyopathy
cfa05417  Lipid and atherosclerosis
cfa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    442859 (NFKB1)
   04014 Ras signaling pathway
    442859 (NFKB1)
   04064 NF-kappa B signaling pathway
    442859 (NFKB1)
   04668 TNF signaling pathway
    442859 (NFKB1)
   04066 HIF-1 signaling pathway
    442859 (NFKB1)
   04071 Sphingolipid signaling pathway
    442859 (NFKB1)
   04024 cAMP signaling pathway
    442859 (NFKB1)
   04151 PI3K-Akt signaling pathway
    442859 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    442859 (NFKB1)
   04218 Cellular senescence
    442859 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    442859 (NFKB1)
   04620 Toll-like receptor signaling pathway
    442859 (NFKB1)
   04621 NOD-like receptor signaling pathway
    442859 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    442859 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    442859 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    442859 (NFKB1)
   04660 T cell receptor signaling pathway
    442859 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    442859 (NFKB1)
   04659 Th17 cell differentiation
    442859 (NFKB1)
   04657 IL-17 signaling pathway
    442859 (NFKB1)
   04662 B cell receptor signaling pathway
    442859 (NFKB1)
   04062 Chemokine signaling pathway
    442859 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    442859 (NFKB1)
   04917 Prolactin signaling pathway
    442859 (NFKB1)
   04926 Relaxin signaling pathway
    442859 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    442859 (NFKB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    442859 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    442859 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    442859 (NFKB1)
   05202 Transcriptional misregulation in cancer
    442859 (NFKB1)
   05206 MicroRNAs in cancer
    442859 (NFKB1)
   05207 Chemical carcinogenesis - receptor activation
    442859 (NFKB1)
   05208 Chemical carcinogenesis - reactive oxygen species
    442859 (NFKB1)
   05203 Viral carcinogenesis
    442859 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    442859 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    442859 (NFKB1)
   05221 Acute myeloid leukemia
    442859 (NFKB1)
   05220 Chronic myeloid leukemia
    442859 (NFKB1)
   05215 Prostate cancer
    442859 (NFKB1)
   05222 Small cell lung cancer
    442859 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    442859 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    442859 (NFKB1)
   05161 Hepatitis B
    442859 (NFKB1)
   05160 Hepatitis C
    442859 (NFKB1)
   05171 Coronavirus disease - COVID-19
    442859 (NFKB1)
   05164 Influenza A
    442859 (NFKB1)
   05162 Measles
    442859 (NFKB1)
   05168 Herpes simplex virus 1 infection
    442859 (NFKB1)
   05163 Human cytomegalovirus infection
    442859 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    442859 (NFKB1)
   05169 Epstein-Barr virus infection
    442859 (NFKB1)
   05165 Human papillomavirus infection
    442859 (NFKB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    442859 (NFKB1)
   05135 Yersinia infection
    442859 (NFKB1)
   05133 Pertussis
    442859 (NFKB1)
   05134 Legionellosis
    442859 (NFKB1)
   05152 Tuberculosis
    442859 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    442859 (NFKB1)
   05145 Toxoplasmosis
    442859 (NFKB1)
   05140 Leishmaniasis
    442859 (NFKB1)
   05142 Chagas disease
    442859 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    442859 (NFKB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    442859 (NFKB1)
   05022 Pathways of neurodegeneration - multiple diseases
    442859 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    442859 (NFKB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    442859 (NFKB1)
   05418 Fluid shear stress and atherosclerosis
    442859 (NFKB1)
   05415 Diabetic cardiomyopathy
    442859 (NFKB1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    442859 (NFKB1)
   04932 Non-alcoholic fatty liver disease
    442859 (NFKB1)
   04931 Insulin resistance
    442859 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    442859 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    442859 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    442859 (NFKB1)
Transcription factors [BR:cfa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    442859 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death
Other DBs
NCBI-GeneID: 442859
NCBI-ProteinID: NP_001003344
Ensembl: ENSCAFG00000010730
VGNC: 43780
UniProt: Q6F3J0
Position
32
AA seq 972 aa
MAEDDTYLGAHEQMFHLDPLTHTIFNPELFQPEMPLPTADGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACTKGYNPGLLVHPDLAYLQA
EGGGDRQLTDREKEIIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEGNGGIWGGFGDF
SPTDVHRQFAIVFKTPKYKDVNITKPTSVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGAGSTGPGYGFPHYGFPTYGGITFH
PGTTKSNAGMKNGTIDTPSKNDSEGCGKNVDREAVNLSGKVTEPTEQDKESSMGVDEVTL
TYTVGIKEENSRFQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDGNG
DSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEAVVDDLLR
AGADLSLLDRLGNSVLHLAAKEGQDKILSILLKHKKAALLMDHPNGEGLNAIHIAVMSNS
MPCLLLLVAAGADVNAQERKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGTTPL
HIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKDGEDEGVVPGTTPLDMATNWQ
VFDILNGKPYEPEFTSDDLLAQGDMKQLTEDAKLQLYKLLETPDPDKNWATLAQKLGQGI
LNNAFRLSPAPSKTLMDNYEVSGGTIKELVEALRQMGYTEAIEVIQAAFCAPETAAPSPG
KGAPQTLSLPLSSASTRSPVDEVRDDSICDSGVETSFRRLSFTESLTSGSSLLTLNKAPH
EYGQEGPIEGKI
NT seq 2919 nt   +upstreamnt  +downstreamnt
atggcagaagacgatacatatttgggagcgcatgagcaaatgtttcacttggatcctttg
actcatacaatatttaatccagaattatttcaaccagagatgccactacccacagcagat
ggtccatatcttcaaatattagagcaacctaaacagagaggatttcgtttccgttatgta
tgtgaaggcccatcccatggtggactccctggtgcatctagtgaaaagaacaagaagtcc
tacccccaggtcaaaatctgcaactatgtgggacctgcaaaggttattgttcagttggtc
acaaatgggaaaaacatccacctgcatgcacacagcctggtgggaaaacactgtgaggat
gggatctgcactgtaactgctggacccaaggacatggtggtcggctttgcaaacctgggt
atacttcatgtgacaaagaaaaaagtatttgaaacactggaagcacgaatgacagaggca
tgtacgaagggctacaatcctggccttttggtgcatccggatctcgcctatctgcaagcg
gaaggcggaggagaccggcagcttacagatcgggaaaaggagatcatccgccaggcagct
cttcagcagacaaaggagatggacctcagtgtggtgcggctcatgtttacagcttttctt
ccagatagcaccggcagcttcacaaggcgcctggaacccgtagtgtcagatgccatctac
gacagcaaagcccccaatgcgtccaacttgaaaattgtaagaatggacaggacagctgga
tgcgtaacaggaggggaagaaatttatcttctctgtgacaaggttcagaaagatgacatc
cagattcgattttatgaagaggaaggaaatggtgggatctggggaggatttggggatttt
tcccccacagatgttcatagacaatttgccattgtcttcaaaacgccaaagtataaagat
gtcaacatcacaaaaccaacctctgtgttcgtccagcttcggaggaaatctgatttggaa
actagtgaacccaaaccttttctctactaccctgaaatcaaagataaagaggaagtgcag
aggaaacggcagaagctcatgcctaatttctcagatagtttcggtggcggtagtggagca
ggagctggaggcggaggcatgtttggcagcggtggtggaggaggcggtgctggaagtacg
ggtccagggtatggtttccctcactatggatttcctacatatggtggaattactttccat
cctggaaccactaaatctaatgccgggatgaaaaatggaaccatagacaccccatctaaa
aatgattctgaaggttgtggcaagaatgtggacagagaggcagtaaacctctctgggaaa
gtaactgaacccacagaacaagataaggagtccagcatgggggttgatgaggttactctg
acatatacagtgggcataaaggaagagaattctaggtttcaagataacctctttctagaa
aaggctatgcagcttgccaagcggcatgccaatgccctttttgactatgcggtgacagga
gatgtgaaaatgctgctggctgtccagcgccatctcactgcagtgcaggatgggaatggg
gacagtgtcttacacttagcgatcatccatcttcatgctcaacttgtgagggatctacta
gaagtcacatctggtttgatttctgatgacattatcaatatgaggaatgatctctaccag
acgcccttgcacttggcagtgattaccaagcaggaggctgtggtggacgacttgctgagg
gccggggccgacctgagccttctggaccgcttgggtaactctgttttgcacctagctgcc
aaagaaggacaagataagattctcagtattttactcaagcacaaaaaggcagcactactt
atggaccaccctaacggggaaggtctaaacgccattcacatagccgtgatgagcaacagc
atgccgtgtctgctgctgctggtggccgccggggccgacgtcaacgcccaggagcggaag
tcggggcgcacggcgcttcacctggccgtggagcacgacaacatctccctggctggctgc
ctgctcctggagggtgatgcccatgtagacagtacgacctacgatggaactacacccctg
cacatagcagccgggagagggtccaccaggctggcagctcttctcaaagcagcaggtgca
gatcctctggtggagaactttgagcctctctatgacctggatgactcttgggaaaaagat
ggagaggatgaaggagtcgtgcctggaaccacacctctagatatggccaccaactggcag
gtgtttgatatactaaatgggaaaccatatgagccagagtttacatctgacgatttactt
gcacaaggagacatgaaacagctgactgaggatgctaaattgcagctctacaagttgcta
gagacccctgatccggacaaaaactgggctactctggcacagaaattaggtcaggggata
ctgaataatgccttccggctgagtcctgctccttctaaaactcttatggataactacgaa
gtctccggggggacaataaaagagctggtggaggccctgagacagatgggctataccgaa
gccatcgaagtgatccaggcggccttctgcgctccggaaactgcggcccccagcccaggg
aagggtgcacctcagaccctctcgctgcccctctcatctgcctccacgaggtcgccagta
gacgaggtccgagacgacagcatctgtgacagcggcgtggagacctccttccgcaggctc
agcttcacagagtctctgaccagtggcagctccttgctgactcttaacaaagcgccccac
gagtacgggcaggaaggaccgatagagggcaaaatctag

DBGET integrated database retrieval system