KEGG   Canis lupus familiaris (dog): 481689
Entry
481689            CDS       T01007                                 

Gene name
TNC
Definition
(RefSeq) tenascin precursor
  KO
K06252  tenascin
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04151  PI3K-Akt signaling pathway
cfa04510  Focal adhesion
cfa04512  ECM-receptor interaction
cfa05165  Human papillomavirus infection
cfa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    481689 (TNC)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    481689 (TNC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    481689 (TNC)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    481689 (TNC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    481689 (TNC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    481689 (TNC)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   481689 (TNC)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_2 EGF_Tenascin Pur_ac_phosph_N DUF2369 EGF fn3_2
Other DBs
NCBI-GeneID: 481689
NCBI-ProteinID: NP_001182078
Ensembl: ENSCAFG00000003426
VGNC: 47646
UniProt: F1PF31
Position
11
AA seq 2201 aa
MGAATRLLAGILLALLTLTTEGGVLKKVIRHKRESGVNVTLSEEHQPVVFNHVYNIKLPV
GSQCSVDLESASGEKELAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCTTGAGCCLQPAEGRLDTRPLCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCHLRGQCLDGQCVCDEGFTGEDCSQLACPSDCNDQGKCVSGVCVCFE
GYTGADCGDEVCPVPCNEEHGRCVEGRCVCQDGFAGEDCSEPLCLNSCHNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCVNGTCYCEQGFSGEDCGQLSCPNACTGRGRCEQGQ
CVCEPGFAGPDCSDRSCPNDCHHRGRCVHGRCECDAGFGGPDCGQLQCPRGCSGHGHCVN
GQCVCDEGHTGEDCGQLRCPNDCHSRGRCVQGQCVCEPGFQGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDLRCPRDCSDRGRCVAGRCECEHGFTGPDCADLACPADCHGQG
RCVNGQCVCHEGFTGATCQERRCPGDCQGRGRCEDGRCTCQEGFTGPDCGQRSCPNGCSG
WGQCVEGRCVCSEGHAGEDCSQVSPPKDLIVTEVTEETVNLAWDNEMRVTEYLVTYTPTH
EDGLEMQFRVPGDQTSTTIRELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETTYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELSYGIK
DVPGDRTTIDLTHDENQYSIGSLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAVDSYRIKYAPISGGDHAEVEVPRSPQATTKTTLTGLRPGTE
YGIGVSAVKADKESDPATINAATDLDAPKDLRVSETTDTHLTLLWRKPSAKFDHYRLNYS
LPSGQPVEVKLPRDTTSYDLRGLEPGKGYSILLTAEKGRHKSKPARLNASTDHAPELENL
TVTEAGWDGLRLNWTAADQAYEHFVIQVQEADTMEAPQNLTVPGSLRAVEVPGLKAATPY
RVTIYGVIRGYRTPVLSAEASTGETPNLGEVMVSEVGWNALKLNWTAPEGAYEQFFIQVQ
ETDSVEAAQNLTVPGGLRSVDLPGLKAATHYSVTIRGLTRDFSTTPLSVEVLTEEVPDLG
NLTVPEVRWDGLTLDWTAPDGFYEQFVIEIQEADQAKEAHSLTVPGNLRSVEFPGLRPGT
PYTITLHGEVGGHSTRPLVVEAITEELPQLGDLAVTEAGWDGLRLNWTAADPAYEHFVIQ
VQEANLVEAPQNLTVPGSLRAVEVPGLKAATPYRVTIYGVIRGYRTPVLSAEASTATGPE
VGNLTVSDITPESFNLSWTATDGAFETFTIEIVDSNRFLETMEYNVSGTERTAHISGLHP
NNHFVIYLSGLAPSIRTKIISATATTEALPLLENLTISDINPYGFTVSWMASENAFDSFL
VTVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFSQGHQTKPLRAEIVTEAE
PEVDNLLVSDATPDGFRLSWTADEGVFDSFVLKIRDTKKQSEPLEITLLAPERTRDITGL
REATEYEIELYGISSGRRSQPVSAIATTAMGSPKEISFSDITEDSATVSWMAPSAQVESF
RITYVPIAGGTSSVVNVDGTKTQTRLMKLLPGAEYLVSVIAMKGFEESEPVSGSFTTALD
GPSGLVTANVTDTEALAMWQPAIAPVDSYVISYTGERVPEITRTVSGNTVEYALTDLEPA
TEYTLRIFAEKGPQKSSIITTKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLV
YESVDGTVKEVILGPETTSYNLAELSPSTHYTAKIQALNGPLRSKLVQTSFTTIGLLYPF
PRDCSQAMLNGDTTSGLYTIYLNGDKAQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNW
KAYAAGFGDRREEFWLGLDNLHKITAQGQYELRVDLRDHGKTAYAVYDRFSVGDAKTRYK
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGD
NNHSQGVNWFHWKGHEYSIQFAEMKLRPSNFRNLEGRRKRA
NT seq 6606 nt   +upstreamnt  +downstreamnt
atgggggctgcgactcggctgttggcgggcatcctcctagctttgctcaccctcacaacc
gaaggtggggtcctcaagaaagtcatccggcacaagcgagagagtggagtgaatgtcact
ctgtccgaggaacaccagccagtggtgtttaaccacgtctacaacatcaagctgcccgta
ggttcccagtgctcggtggacctggagtcagccagtggggagaaagagctggccccacct
tcagagcccagcgagagcttccaggagcacacggtcgacggggaaaaccaaattgtcttc
acacaccgcatcaacatcccccgccgggcctgtggttgcgcggcagctcctgatgtcaag
gagcttctgagcagattggaggagctggagaatcttgtgtcttccctgcgagagcagtgc
accacgggagctggctgctgtctccagcctgccgaaggccgcctggacaccaggcccttg
tgcagcggccgcggaaacttcagcacggaaggctgtggctgtgtgtgtgagccgggctgg
aaaggccccaactgctcggagcccgaatgtcccggcaactgtcacctgcgaggccagtgc
ctggacggccagtgcgtctgcgacgagggtttcacgggggaggactgcagccagctggcc
tgtcccagcgactgcaacgaccagggcaagtgcgtgagcggggtctgcgtgtgtttcgaa
gggtacacgggcgccgactgcggcgacgaggtgtgcccggtgccctgcaacgaggagcac
ggcaggtgcgtggagggccgctgcgtgtgccaggacggcttcgcgggcgaggactgcagc
gagcccctgtgcctcaacagctgccacaaccgcgggcggtgcgtggagaacgagtgcgtg
tgcgacgagggcttcacgggcgaggactgcagcgagctcatctgccccaatgactgcttc
gaccgcggccgctgcgtcaacggcacctgctactgcgagcagggcttctcgggcgaggac
tgcggccagctcagctgccccaacgcctgcacgggccgcggccgctgcgagcagggccag
tgcgtgtgtgagccgggctttgccgggcccgactgcagcgacaggagctgccccaacgac
tgccaccaccgcggccgctgcgtgcacggcaggtgcgagtgcgacgccggcttcggcggg
cccgactgcggccagctccagtgtcccaggggctgcagcggccacggccactgtgtcaac
gggcagtgcgtgtgcgacgagggccacaccggggaggactgcggccagctgcggtgcccc
aacgactgtcacagccgcggccgctgcgtgcagggccagtgcgtgtgcgagccgggcttc
cagggctacgactgcagcgacatgagctgccccaacgactgccaccagcacggccgctgc
gtgaacggcatgtgtgtctgcgacgacggctacaccggggaggactgccgcgacctgcgg
tgccccagggactgcagcgaccggggccgctgcgtggccgggcggtgcgagtgtgagcac
ggcttcacgggccccgactgcgccgacctcgcgtgccccgcggactgccacggccagggc
cgctgtgtgaacgggcagtgtgtgtgccacgagggcttcacgggcgccacgtgccaggag
cggaggtgccccggcgactgtcagggccggggccgctgcgaggacggtcggtgcacctgc
caggagggcttcacgggcccggactgcgggcagcgctcgtgccccaacggctgcagcggc
tgggggcagtgcgtggagggccgctgcgtgtgcagcgagggccacgccggggaggactgc
tcccaggtgtcccctccgaaagacctcatcgtgacagaggtgacggaagagaccgtaaac
ctggcctgggacaacgagatgcgggtcacggagtacctcgtcacctacacacccacccat
gaggacggcctggagatgcagttccgcgtgcccggggaccagacatccaccaccatccgg
gagctggagcccggcgtggagtacttcatccgcgtgttcgccatcctggaaaacaagaag
agcattcccgtcagcgcccgagtggccacttacttaccggcacctgaaggcctgaagttc
aagtccatcaaggagacgtctgtggaagtggagtgggatcctctggacattgcttttgaa
acctgggagatcatcttccggaatatgaataaagaagatgagggagagatcaccaaaagc
ctgaggaggccagagaccacataccggcagactggcctggcgcccgggcaagagtatgag
atctctctgcacatcgtgaagaataatacccggggcccaggcctgaagagggtgaccaca
acccgcttggatgcccccagccaaatcgaggtgaaagatgtcacggacaccactgctctg
atcacttggttcaagcccctggctgagattgacggcattgaactctcctacggaatcaaa
gatgtgcctggtgaccgtaccaccatcgatctcacacatgatgagaaccagtactccatt
gggagcctgaagccagacaccgagtatgaggtgtctctcatctcccgtagaggtgacatg
tccagcaacccggccaaagagaccttcacaacaggcctggatgctcctagaaatctccgt
cgtgtctcccagacagacaacagcatcaccctggaatggaggaatggcaaggcagctgtt
gacagttacagaattaagtacgctcccatctctggaggtgaccatgccgaggtcgaagtc
ccaaggagcccacaagccaccaccaaaaccacactcacaggtctgaggccaggaactgaa
tatgggatcggagtgtctgctgtgaaggcagataaggagagcgatccagccaccatcaac
gcggccacagacctggatgcacccaaggaccttcgggtgtctgaaactacagatacccac
ctgaccctactctggaggaagccttcagccaagtttgaccattaccgcctcaactacagc
ctgccctcaggccagccagtggaggtgaagctccccagagataccacctcctacgacctg
agaggcctggaacctgggaagggatactccatcctcctgacagcagagaagggcaggcac
aagagcaagcctgcacggctaaatgcatccacagaccatgcccctgaactggaaaacctc
accgtgaccgaggctggctgggatggcctcagactcaactggaccgcagctgaccaggcc
tatgagcactttgtcattcaggtgcaggaggccgacacgatggaggcacctcagaacctc
acggtgccaggcagcctgcgggccgtggaggtcccgggcctcaaggccgccaccccttac
agagtcaccatctacggggtgatccggggctatagaacaccggtgctctctgccgaggcc
tccacaggggaaactcccaatttgggagaggtcatggtgtccgaggtgggctggaacgcc
ctcaaactcaactggaccgctccggaaggggcctatgaacagtttttcattcaggtgcag
gagactgactcggtagaggcagcccagaacctcacggtccctggaggactgaggtccgtg
gacctgcctgggctcaaagcagccactcattatagcgtcaccatccgtgggctcacgcgg
gacttcagcacgactcctctctctgttgaagtcttgacagaggaggttccagatctggga
aacctcacagtgcccgaggttcgctgggatggcctcactctggactggaccgcccccgat
gggttctatgagcagtttgtcattgagatccaggaggctgaccaggccaaggaagctcac
agtcttacggttcctggcaacctgcgctctgtggaattcccaggcctcaggcccgggacc
ccttacaccatcactctgcacggcgaggtggggggccacagcactcgaccccttgtggtg
gaggccatcacagaggagctcccccagctaggagacttagccgtgaccgaggctggctgg
gacggcctcagactcaactggaccgcagctgacccggcctatgagcactttgtcattcag
gtgcaggaggccaacctggtggaggcacctcagaacctcacggtgccgggcagcctgcgg
gccgtggaggtcccgggcctcaaggccgccaccccttacagagtcaccatctacggggtg
atccggggctatagaacaccggtgctctctgccgaggcctccacagccacaggacctgaa
gtgggaaacttaactgtttctgacataactcctgagagcttcaatctctcctggacagcc
accgatggggccttcgagacctttaccattgaaattgttgattccaataggtttttggag
acgatggaatacaatgtctctggcactgaacgaactgcccacatctcagggctacaccct
aataatcattttgttatctacctctcggggctcgctcccagcatccggaccaaaatcatc
agtgccacggccaccacagaggccctgccccttctggaaaacctaaccatttccgacatt
aatccctacgggttcacagtttcctggatggcatcggagaatgcctttgacagcttccta
gtaacggtggtggattctgggaagctgctggacccccaagaattcacactttcaggaacc
cagaggaaattggagcttagaggcctcataactggcattggctatgaggttatggtctct
ggcttcagccaagggcaccaaaccaagcccttgagggctgagattgttacagaagccgag
ccagaggttgacaaccttttggtttcagacgccaccccagatggtttccgtctgtcctgg
acagctgatgagggggtcttcgacagttttgttctcaaaatcagagataccaaaaagcag
tctgagccactggaaataaccctacttgcccccgaacgaaccagggacataactggtctc
agagaggccactgagtatgaaattgaactctatggaataagcagtggaaggcgatcccaa
ccagtcagtgccatagcaacaacagccatgggctctcccaaggagatcagtttctcagac
atcactgaagattcggccactgtcagctggatggcgccctcggcccaggtggagagcttc
cggattacctacgtgcccattgcaggagggacatcctcagtggtaaatgtggatggaacc
aagacccagaccaggctgatgaagctcttgcctggagcagagtaccttgtcagtgtcatc
gccatgaagggcttcgaggaaagtgaaccagtctcaggatcgttcaccacagctctggat
ggcccatctggcctggtgacagccaatgtcaccgacacggaagccctggccatgtggcag
ccagccattgcccctgtggacagttatgtcatctcctacacaggggagagagtgccagaa
attacacgcacagtgtccgggaacacggtggagtatgccctgaccgatctcgagcctgcc
accgagtacacactgaggatctttgcagagaaagggccccagaagagctcaatcatcacc
accaagttcacaacagaccttgattctccaagagacttgactgccactgaggttcagtca
gaaactgccctcctcacctggagacccccccgggcatctgtcaccggttacctattggtg
tatgaatctgtggatgggacagtcaaggaagtcattttgggtccagaaaccacctcctat
aacctggcagagctgagcccatccacccactacacggccaagatccaagcgttgaatggg
cccctgaggagcaagctggtccagaccagctttaccacaattggactcctgtacccattc
cccagggactgctcccaagcaatgctgaatggagacacaacctccggcctctacaccatt
tatctgaatggtgataaggcccaggctctggaagtctactgtgacatgacctccgatggg
ggtggatggatcgtgttcctgaggcgcaagaacggacgtgaggatttctatcgcaactgg
aaagcctacgctgctgggttcggggaccgcagagaagaattctggcttgggctggacaat
ctacacaaaatcacagcccaagggcagtacgagctccgggtagacctgcgggaccacggg
aagacagcctacgccgtctatgacaggttcagcgtgggggatgccaagactcgctacaag
ctgaaggtggaggggtacagcggaactgcaggtgactccatggcttaccacaatggcaga
tccttctctaccttcgacaaggacacggactcagccatcaccaactgtgccctatcctat
aagggggctttctggtacaagaactgtcaccgtgtcaacctgatggggagatatggggac
aacaaccacagtcagggcgttaactggttccactggaagggccacgaatattcaatccag
tttgctgagatgaagttgaggcccagcaacttccgaaatctcgaaggcaggcgcaaacgg
gcgtaa

DBGET integrated database retrieval system