KEGG   Canis familiaris (dog): 483708
Entry
483708            CDS       T01007                                 

Gene name
ZDHHC24
Definition
(RefSeq) probable palmitoyltransferase ZDHHC24
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    483708 (ZDHHC24)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     483708 (ZDHHC24)
SSDB
Motif
Pfam: DHHC
Other DBs
NCBI-GeneID: 483708
NCBI-ProteinID: XP_540829
Ensembl: ENSCAFG00000012576
VGNC: 48590
UniProt: E2RIK9
Position
18
AA seq 284 aa
MGQPWAVGSAEGAPARLPLVLTALWAAAVGLELAYVLVLGPGPPPLGPLARALQLVLAAF
QLLNLLGNVGLFLRSDPSIRGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRR
DHHCRLLGRCVGFHNYRPFLCLLLHAAGVLLHISVLLGPALSALLRAHAPLHTAALLLLP
WLMLLTGRVSLAQFALAFVTDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGQHSYDLG
PCHNLQAALGPRWVLVWLWPFLASPLPGDGITFQTAADVGLTPS
NT seq 855 nt   +upstreamnt  +downstreamnt
atggggcagccctgggcggtagggagcgcggagggggcgcccgcgcggctgcctctcgtg
ctcaccgcgctgtgggccgcggctgtgggcctggagctggcctatgtgctggttctgggt
cccgggccgcccccgctgggacccctggctcgggccttgcagttagtgctggccgccttc
cagctgctcaacctgctgggcaacgtggggctcttcctgcgctcggaccccagcatccgg
ggcgtgatgctggccggccgcggtctgggccagggctgggcttactgctaccagtgccaa
agccaggtgccaccacgcagtgggcattgctctgcctgccgtgtctgcatccttcgtcgg
gatcaccactgccgcctgctgggccgctgtgtgggattccacaactaccggcccttcctg
tgcctgttgcttcatgctgcgggtgtcctgctccacatctctgtgctgctgggccctgcc
ctgtcagccctcctgcgagcccacgcgcccctccacaccgcagccctcctcctgctgccc
tggctcatgctgctcacaggcagagtgtctctggcgcagtttgccttggcctttgtgacc
gatacatgcgtggcaggtgcactgttatgtggggctgggctgctcttccatgggatgctg
ctgttgcggggccagaccacgtgggagtgggctcggggccagcactcttatgacctgggc
ccttgccacaacttgcaggcggccctggggccccgctgggtccttgtctggctctggccc
ttcctggcctccccactgcctggggatgggatcaccttccagaccgcagctgatgtgggc
ctcacaccttcctga

DBGET integrated database retrieval system