KEGG   Canis lupus familiaris (dog): 484808
Entry
484808            CDS       T01007                                 

Gene name
NCAN
Definition
(RefSeq) neurocan core protein isoform X2
  KO
K06794  neurocan core protein
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:cfa00535]
    484808 (NCAN)
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    484808 (NCAN)
   04091 Lectins [BR:cfa04091]
    484808 (NCAN)
Proteoglycans [BR:cfa00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   484808 (NCAN)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   484808 (NCAN)
Lectins [BR:cfa04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   484808 (NCAN)
SSDB
Motif
Pfam: Xlink Lectin_C Sushi EGF V-set hEGF EGF_2
Other DBs
NCBI-GeneID: 484808
NCBI-ProteinID: XP_005632716
Ensembl: ENSCAFG00000014218
VGNC: 43638
UniProt: A0A5F4C4W8
Position
20
AA seq 1249 aa
MGTTSVWASGLLMLQMLLFVAGEQSTQDSTAAASANIDKGLHMQKVGSGLVRAALAELVA
LPCLFTLRSWPGAAREAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKGWQGRVSLPAY
PRHRANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRAAQDRYALTFA
EAQEACRLSSATIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPG
VRSYGRRDPRELYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLA
WHEGLDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPAPGARFDAYCF
RAHHPTPHQHGDPETPSSGDEGEILSAEGPPAQELEPSIGEEMVTPDFQEPLVSSGEEEP
LILAEKQQSRETPSPAPGGFTLASRPSLEAEEAWLSPATPSPSSLSTAVGTHTEATPTGP
IPRKRGRFKGLNGRHFQQQEPQQGLEMGLEAGTQPPTPEAPGNHVEPLLATGATDASGTS
RSQSPWAVLTNEVDMPEAGSPGGRSPPESWLWPPTVVPPSIPGPSRVLGLELEEAKGPSV
RPATPDLPWSPSEGTALAPSPSEGPSSASWEVAPMVSSPDLPVMAMLRAPKLWLQPHPTP
LPTQADRVKGHSEAIATISPSPASDTEVIPQDPIHPEVHSLSLSSVPTGQGREATSSTVG
SHRAGYPIGFSQTATDTQTGPSPDSPRADFGETGGTSPTGLSKAELPRSTPQASVDRNVE
DFAPTETAIEPPGVRDISRSDSQATMDEAQGTWPSLHSEGLDSLPTSAPSGVPRVFLIPG
VTPSLEPWAAINGEAMLGPTDSTANLDPSDAVSSGEPTMPGDTPSTHPPASLDPEEFELE
VLAGSPDVEGFWEETASGEEPTLPGIPGNRSAEEAPLDPCENNPCLHGGTCKANGTMYGC
SCDQGFTGENCEIDIDDCVSSPCENGGTCIDEVNTFVCLCLPSYGGSLCEKDTEGCDHGW
HKFQGHCYRYFAHRRAWEDAERDCRRRAGHLTSIHSPEEHSFINSFGRENTWIGLNDRIV
ERDFQWTDNTGLQYENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPCNYNLPYVCKKGT
VLCGPPPAVQNASPIGARKTKYNVHATVRYQCDEGFTQHHVAIIRCRSNGKWDQPQIVCT
KPRRSHRMRRHHHHHQHHHQHHHHKSRKERRKHKKHPVEDWEKEEGNFC
NT seq 3750 nt   +upstreamnt  +downstreamnt
atggggaccacatctgtctgggcctcaggcctcctgatgctccagatgctgctgtttgtg
gctggagaacagagcacacaggactccactgctgctgcctccgccaacattgacaaaggg
ctccacatgcagaaggtggggtcagggttggtccgggctgcactggcagagctggtagcc
ctgccttgtctcttcaccctgcggtcatggccgggtgcagcccgagaagcccctcggatc
aagtggaccaaggtgcggactgcatcgggccagcgacaggacttgcccatccttgtggcc
aaggacaatgtggttcgagtggccaagggctggcagggacgcgtgtcactgcctgcctac
ccccggcaccgggccaatgcaacactgctcctgggacccctgagggccagcgactctggg
ctttaccgctgccaggtggtgaggggcatcgaggatgagcaggacctggtgcccctggag
gtgacaggtgttgtgttccactaccgggcagctcaggatcgctatgcactgacctttgca
gaggcccaggaggcctgccgtctcagctcagccaccattgcagccccacggcacctgcag
gctgcctttgaagacggctttgacaactgtgatgccggatggctctctgaccgcactgtt
cggtatcctatcacccagtcccgtcctggttgctatggtgaccgtagcagccttccaggg
gtgaggagctatgggaggcgcgacccacgggaactctacgatgtgtattgctttgcccgt
gagctggggggcgaggtcttctatgtgggcccggcccgccgcctgactctggccggcgcg
cgtgcccagtgccgccgccagggcgccgcgctagcctcggtgggacagctgcacttggcc
tggcacgagggcctggaccagtgcgacccgggctggctggccgacggcagcgtgcgctac
ccgatccagacgccgcgccggcgctgcgggggcccagccccgggcgtgcgcaccgtctac
cgcttcgccaaccgcaccggcttcccggcgcccggagcgcgcttcgatgcctactgcttc
cgagctcatcacccaacaccacatcaacatggagacccagagaccccctcatctggggat
gagggggagatcctgtcagcagaagggcccccagcccaagaactggagccgagcattggg
gaggagatggtcacccctgacttccaggagcctctagtgtccagtggggaggaagagcct
ctgatcttggcagagaagcagcagtctcgggagacccccagccctgcccctggaggcttc
acgctagcctcaaggccctccctggaggctgaagaggcatggctgagcccagcgaccccc
agccccagcagccttagcactgcagtgggcacacacacggaggcaactccaactggcccc
atacccaggaagaggggacgctttaaaggattgaatgggcgccacttccagcagcaggaa
ccccagcaaggcctggagatggggcttgaggccggcacccagcccccgaccccagaggct
cctgggaatcacgtggagcctctgctggccaccggagccacagatgcctcagggactagc
cggagccaaagcccctgggctgtgctgaccaatgaggtggatatgcctgaggctggttcc
cctggtggcaggagccctccagagtcctggctgtggcccccaaccgtggtcccacctagc
atcccaggccccagcagggtccttggcctggaacttgaggaagccaagggccccagtgtg
aggccagccactcctgacctgccctggtccccctcagagggcactgccctggcacccagc
ccctcagagggccccagctctgcttcctgggaggtagctcccatggtctcttccccagac
ctccctgtcatggccatgcttcgtgccccgaaactgtggcttcagccacaccctacaccc
ctccccacgcaggccgacagggtcaaggggcatagtgaggccatagccaccatctcaccc
tctcctgcctcagatactgaggttatcccccaggaccccatccatccagaggtgcattcc
ttgtccctctcctcagtcccaacaggacagggtagagaggccacatcctcaacagtcggc
agccacagagcgggatatccaataggtttctcgcagacagccacagacacacaaactgga
cccagtcctgactctcccagggcagactttggagaaactggggggaccagccctactggg
ctcagcaaagctgagctccccagatccactccacaagcttctgtggacaggaatgtggaa
gatttcgcccccactgaaacagccattgagcccccaggagtgagagacatctcgaggtct
gactctcaggccaccatggacgaggcacagggcacgtggccctcactgcacagtgagggg
ttggactctctccccacatctgcaccctcgggggtccccagagtcttcttgattcctggg
gtcaccccaagtttggaaccttgggctgctataaatggagaagccatgttggggcccacg
gattccacagccaacctggatcccagtgatgctgtttcctcaggagagcctacaatgcca
ggggacacccccagcacccatccgcctgcctccctggacccagaggagtttgagctggag
gtcctggcagggagcccagatgtggagggcttctgggaggagacagcaagtggagaagag
ccgaccctaccagggatccctggaaacaggagtgcagaggaggcccccttggatccatgc
gagaacaacccttgcctgcatggcggtacctgtaaagccaatggcaccatgtatggctgt
agctgtgaccagggcttcaccggggagaactgtgagatcgatattgatgactgtgtctcc
agcccctgtgaaaatggaggcacctgcattgacgaggtcaacacattcgtctgtctttgc
ctccccagctatgggggcagcctctgcgagaaagacacagagggctgtgaccatggctgg
cacaagttccagggccactgctaccgctattttgcccatcgacgggcatgggaggacgcc
gagagggactgccgccgccgagctggccacctgaccagcatccactcgcctgaggagcac
agcttcattaacagctttgggcgtgaaaacacctggatcggcctgaatgacaggatcgtg
gagagggatttccagtggacggacaacacagggctgcaatatgagaactggcgggagaat
cagcctgacaatttcttcgcgggtggggaggactgtgtggtgatggttgcacatgagagc
ggccgttggaacgatgttccctgcaactacaacctcccgtatgtctgtaagaaggggaca
gtgctgtgtggcccccctccagcagtgcagaatgcctcacccattggtgctcgcaagacc
aagtataatgtccatgctactgtacgataccagtgtgatgaaggatttacccaacaccat
gtggccatcatccgatgccggagcaatggcaagtgggaccagccccagattgtctgcacc
aaacccagacgatcccatcggatgcggcgtcaccatcaccaccaccagcaccatcaccag
catcaccaccacaaatcacgcaaggagcgtagaaaacacaagaaacacccagtagaggac
tgggagaaggaagaagggaatttctgctga

DBGET integrated database retrieval system