KEGG   Canis lupus familiaris (dog): 486205
Entry
486205            CDS       T01007                                 
Symbol
FARP2
Name
(RefSeq) FERM, ARHGEF and pleckstrin domain-containing protein 2 isoform X22
  KO
K06082  FERM, RhoGEF and pleckstrin domain protein 2
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04015  Rap1 signaling pathway
cfa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    486205 (FARP2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    486205 (FARP2)
SSDB
Motif
Pfam: RhoGEF PH FERM_C FERM_N FA FERM_M PH_13 IQ_SEC7_PH PH_20
Other DBs
NCBI-GeneID: 486205
NCBI-ProteinID: XP_005636039
Ensembl: ENSCAFG00000012990
VGNC: 40731
Position
25:51544508..51638156
AA seq 1045 aa
MGEIEGTYRVLQTPGTRLGAQTLAGVSTLEPGQTLSGAATRASAKMQEKHLHIRVKLLDN
TVEIFDVEPKRDGQALLTQVWRHLNLTECDYFGLELQHPRSYWIWLEPMKPIIRQVRRPK
NTLLRLAVKFFPPDPGQLQEEFTRYLFALQLKRDLLEERLPCADTTAALLASHLLQSEIG
DYDETLDREHLKANEYLPSQERFLEKILEFHRKHTGQTPAESDFQVLEIARKLEMYGIRF
HPASDREGARINLAVSHMGVLVFQGTTKINTFNWSRVRKLSFKRKRFLIKLHPEVRGPYQ
DTLEFLLGSRDECKNFWKICVEYHTFFRLFDQPKAKAKAVFFSRGSSFRYSGRTQKQLVD
YVRDSGVKRVPYERRHSKTRASLRALTADLPRQSISFTEGMRTSASPASTNASFYSVPTS
PLAPRGPCDFKDSSGSLTEPQAPDAKRPAAERSGGAAADGDARRAQSPGPPAPQPCQGLS
AESPQPSPSTRKSPPSLSPASRVTLGLTGQGSSPLLSPALSDAGGVRTDGEEEPRHKGPA
ADEAYFIAKEMLATERTYLKDLEVLTVWFRSAVVREDAMPADLMTLLFSNIDPIYEFHRR
FLREVEQRLALWEGSSNTHATAGHQRIGDILLRNMHQLKDFTSCFQRHDEVLSELEKAAR
RGGKLAAACRAFELQRVCYLPLNAFLLKPVQRLLHYRLLLSRLCGLYAPAHPDSADCRDA
LQAITEVTSALQHSLARLENLQKLTELQRDLVGVDNLVTPGREFIREGCLHKLTKKGLQQ
RMFFLFSDVLLYTSRGVTGTSRFRIRGRLPLRGMLVEEGERERSVPHCFTICAAQKTIVV
AASTRLEKEKWMRDLNDAIDMAKRGSDLSLVLPGSVLCAPPYRSSEEASLEQEAEEAGGP
HGSLEGQGQRRANTTVHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSSGWQKLWVVF
TNFCLFFYKTHQDDHPLASLPLLGYSVSVPEEADGVHKEHVFKLQFKSHVYFFRAESKYT
FERWMEVIERASSSPARAGPSEAAA
NT seq 3138 nt   +upstreamnt  +downstreamnt
atgggggagatagaaggaacgtacagagtcctgcagactccagggacacgcttgggcgcc
cagaccctggcgggggtgagcaccctcgagcctgggcagactctgtcgggagcagcgaca
cgggcgtcagccaagatgcaggagaagcaccttcacatccgggtgaagctgctggacaac
actgtggaaatctttgacgtcgagcctaagcgcgatggccaggcgttgctgacgcaggtg
tggcggcacttgaacctgacggagtgtgactacttcgggctggagttgcagcacccccgg
tcctactggatttggctggaacctatgaagcccatcattaggcaagtacgaaggccaaag
aacacattgcttcgtctagcagtgaaatttttccctcctgatccgggtcagttgcaggaa
gaatttacaagatacttgtttgccttgcaacttaagagagacctcctggaggagcgtctg
ccctgcgcggacaccacggcggcgctgctggcatcccaccttctgcagtcggaaatagga
gattatgatgaaaccctggaccgagagcacctcaaagccaatgagtacctgcccagtcag
gagcgctttcttgagaagattctagaattccaccggaagcacacgggccagacgcctgcc
gagtcagatttccaggtgcttgaaattgcccggaagttggaaatgtacggcatcagattt
cacccagcctcggacagggagggggccaggattaacctggctgtctcgcacatgggcgtc
ctcgtgttccagggcaccaccaaaattaacactttcaactggtccagggtccgaaaactc
agcttcaaaaggaaaaggtttctcatcaaactgcacccagaggtccgtggaccttaccag
gacacgctggagttcttgttgggcagtagagatgaatgtaagaacttctggaagatctgt
gtggagtaccacaccttctttaggctcttcgatcaacctaaggccaaagctaaagccgtc
ttcttcagcaggggctcgtccttcagatacagtggaagaactcagaaacagctggtggat
tacgtcagggacagtggggtgaagagagttccatatgaaagaagacacagcaagacgcgg
gcgtctcttcgtgctctgactgcagacttgccaaggcagagcatctcattcaccgagggc
atgaggacttccgcgtccccagcttcaacaaacgcctccttctattcagttcctacctcc
ccgctggccccccgaggcccgtgtgatttcaaagacagcagtggctccctcacagagccc
caggctcccgacgccaagaggccagctgcagagaggagcggcggagcagcagccgacggc
gacgccagacgggcccagtcccctggaccccctgcaccgcagccttgccaaggcctttcc
gcggagagtcctcagccttctccctccacccggaagagcccaccgagcctgagccccgcg
tctcgggtgactctgggcctgaccgggcagggctcgtcccccctcctgagccctgccctt
agcgacgccggtggagtcaggacggacggcgaggaggagccgagacacaagggcccggca
gccgacgaggcctacttcatagcgaaggagatgctcgccacagaacggacgtacctgaag
gacttggaagttctcaccgtgtggttccgcagcgctgtggtcagggaggacgccatgccc
gcggacctgatgaccctgctcttctccaacatagaccccatctacgagttccacagacgc
ttcctgcgcgaggtggagcagaggctggcgctctgggaagggtcttccaacacccatgcc
acagccggtcaccaacgaatcggggacatcctgctcaggaacatgcatcagttaaaggac
ttcaccagctgcttccagaggcacgacgaggtcctgagcgagctggagaaggcggcccgg
cgcggcgggaagctggcggccgcgtgcagggccttcgagctccagagggtctgctacctg
cccctgaacgccttcctgctgaagcccgtccagcgcctgctgcactaccgcctgctgctc
agccggctgtgcggactgtacgcgcccgcgcaccccgactccgcggactgccgggacgcc
ctccaggccatcacagaggtgacgtccgcactccagcacagcctcgcccggctggagaac
ctccagaagctgacggagctgcagcgggacttggtcggtgtagacaacctcgtcaccccg
ggcagggagttcatccgcgaggggtgccttcacaagctcaccaagaagggcctgcagcag
aggatgttctttctgttctcagacgtgctgctgtacacgagcagaggagtcacgggcacc
agccgcttccggatccggggccgcctcccactccgcggcatgctggtagaagaaggcgag
cgtgaacgctctgttccacactgtttcaccatctgtgcggctcagaaaacaatcgtggtg
gcagccagcacccgcctggaaaaggagaagtggatgcgtgacctgaacgacgccatcgac
atggccaagcgcgggagtgacctctccctggtgctgccgggcagcgtgctgtgcgcgccc
ccctacaggtcctcggaggaggcctctctggagcaagaggcagaagaggctggcggcccc
cacggctctctggaggggcagggccagcgccgggccaacaccacggtccacgtgtgctgg
taccgcaacaccagcgtctccagagccgaccacagcgcggctgtcgagaatcagctttcg
ggctatctgctgagaaaattcaagaacagtagcggctggcagaagctctgggtggtcttt
accaacttctgtttgttcttctacaagactcatcaggacgaccaccccctggccagcctc
ccgctgctgggctacagcgtcagcgtccctgaggaggccgacggcgtccacaaggagcac
gtcttcaagctccagttcaagtcccacgtctacttcttccgggctgagagcaagtacacg
tttgagaggtggatggaggtgatcgagcgcgccagtagctcgcctgcgcgggccgggcct
tccgaggcagcagcatga

DBGET integrated database retrieval system