KEGG   Canis familiaris (dog): 487519Help
Entry
487519            CDS       T01007                                 

Gene name
STARD9
Definition
(RefSeq) stAR-related lipid transfer protein 9
  KO
K16491  StAR-related lipid transfer protein 9
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    487519 (STARD9)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    487519 (STARD9)
   Spindle formation proteins
    487519 (STARD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd START Yop-YscD_cpl FHA Kinesin_assoc
Motif
Other DBs
NCBI-GeneID: 487519
NCBI-ProteinID: XP_005638369
Ensembl: ENSCAFG00000011155
VGNC: 46889
UniProt: J9NZ42
Position
30
AA seq 4705 aa AA seqDB search
MANVRVAVRVRPLSKREIKEGGRIIVEVDGNVAKIRNLKVDSRPDGFGDFREKIVAFGFD
YCYWSVNPEDPQYASQDVVFQDLGTEVLSGAAKGYNICLFAYGQTGSGKTYTMLGTPTSV
GLTPRICEGLFIREEDYAPLPSSCRIKVSFLEIYNERVRDLLKQSDKKKSYSLRVREHPE
LGPYVQGLSQHVVTNYKQVIQLLEEGIANRITAATHIHEASSRSHAIFTIYYTQAVLENN
LPSEIASKINLVDLAGSERADPSYCKDRITEGANINKSLVTLGIVISTLAQNSQAFSSCQ
SLNSAASDGDSGIPSSPSGTSSGAGPSRRQSYIPYRDSVLTWLLKDSLGGNSKTIMVATV
SPAHTSYSETMSTLRYASNAKHIINKPRVNEDANVKLIRELREEIRRLKAMLLNFELRNF
SPLNEEKDENLKELVLQNELKIDHLTKDWTQKWNEWKALVENYRVDINRRRAGVVIDSSL
PHLMALEDDVLSTGVVLYHLKEGTTKIGRIDSEQEQDIVLQGQWIERDHCTITSACGVVI
LRPARGARCTVNGREVTASCRLTQGAVITLGKAQKFRFNHPAEAAVLRQRRQVGEAVGGS
GSLEWLDLDGDVTTSRLGISPLLWKKRRVLEELSDEDHQPLRAGEAPHRAQIQQQHYVGD
LRQRILAGQIRAKQDLELDQAHISRQIKDNQQWLLGDEIWLTGLQQQDHVAEKELKACVP
SGAWLQTDSETQLSPLVRSQKREVRLRLGCRNALRVAQRDIRRRKASFQLERIKKQRLLE
SQKGLEPSKASCWLQDDCTQKPPYWVPSTDAMLPGPQHRSRLPGCSSLSLRGLCSWYFPQ
LHSIFLNRDPSTMPDPTDQISEKIPSEEYFPQAAAYPPRTGHFSKNAHCSSGRGPLCTAR
GALARKGASVSGTCLTVSSESASIQEMERAGKQPCRMVSQSLASLDHSVNKLKPRDNKPV
ALTPSTYIRWGRGLADSDHTRAEWQKEENLGTHKTAKGACCSSSQPCGPKQASGHGKAAE
IFWVESKPPSQSRASKRQQRVLVKDIVKKSSCLPHGSPLRRQYHVGDPDSTSSLTDSSPR
VDHIRDRNGDLSDTNSRYSVDSLSCVYAKALMEPLKPEDPQGKEQGLPEPENSESDDSQI
SEDSLAEKGYESPPDNPGSSYLPSGHGHPRTRVMASVRGFTTSSNSGLFTQTHRSFSLDS
LIDAKEELREEQQEEGFFSSADEMPTETFWHLQTSSLPIVEQEAMCRLGPISNGTVARLD
AILPMSSSFYLGPPPQPPCEQPESEVEASSSEQTNMLQGLQLSRGSPLLSMDSWFSCDSK
INSSSPSGIVGSLCPSPDVQESQPHGWERPGHGQNIEELKPSGAEILLPYTSKLPQGGTE
LPCCVRGVYTIPASDTSKLSFWGSHRLLQPRVAGIFQARGIPDTAQEGNSEASNNSSVSS
VLAASAASFTHVGSTHERDWGALQQKYLPELSHPVLEAIRESRPTFSSLEEDSASLTQGS
GKETDTLLPVGSGVSSSLDFSNFPVHLSKIQCLRAEKEQDSLSAELEGTSDFFTIREKEV
SHSGTYSADVESLTSGTTNVVPVFAAESKMANSMREVCQVKQNNLEESSQSSGKPQRMSS
SDECFFLKSPCHSNITIVSKENHWPQGWAPPMKNSAAQEGQLSHPGYPPLQEEKVDYQES
SREVVRRHPSVSFAFLSGPKMYPHSGAWNPLPSSLQPPPLETFYVTKSRDALTETALEIP
ACRESRVPSPSPREAWGFGHDHQVLQNIYFKNNFPVLLQNQNSKTASSQQVTAGRPVDLN
TKEVSRERGKCPGNIEEESHNSVYFFVAQNKHFLSSTSTKVCEFENQVGILNNHNLSALK
EREKATVQSCFNVCSSHSRSRKPLLVCESEADGEEEQDHNVVLRQTQALDMNRQFPSGAR
SDFIYETINLALDNDMLGEAAISLQSRSVHHRVSGPKIMAPDESPAHKGERKNESGLLGK
AFHPKDSSKEFKHPKTESIYERFQSVTCSQEKNLNESKGPGRSEEMLSPKEEPSGKKQNK
RVNSGDEMARLIRSVIQLEDGILEIESKQNKQLSASQTLGVGKEFVFWDQRDQEMADYVL
RPSSFGNYVSLKDQPSSPKQTDDVTFRDSEAREMEVDSSTGEGLQAQKITLSPFRSRECI
QDTKFAKEDTCPAVLNRSSRDTCDYVRTCTVCREFTDTCANPRTKALASALPLQPSPKMS
SEKESEAENASASPPTRQPCGLGSLEELETVKDFWETQVAKCISSSKQEEPKVQGRVEEM
AVRRGGNLQEENTVVSLIQQLPSPSQCCIGTSSSQEIGPLLSQPDFSEAPHGNLHSSLPL
NSPRLPRDCLHVHDTVGISSVDYVLDPTILKIPNSPLVTGAESQDLCGEPQSHSPQGTIR
EGSSSAHSAWCGSVISTSMRSHGQFCVSENIPLGAEGKRSVSTQDQGGDLRSILMGLSSR
DGFASEAEAAVQRGTERATSLNRASSPLEKKASCLLEEGNSQGCPAEEAEDLYLPSGTFS
APVSLPRMPLPERCAHTSMGLGVLEEITQAQAEGKQLHDLGAGGNILPYYETLLGPECSS
GVTDQSLSDRTRNEAEAQRFHVASLSAEPGHLLTNERKVSQATPLPADSFQHLPSTETHI
VPQPTSQISSHVAPTLGKSYCSGELRLFLGAGEQLVCHSSSSGIIEKKKKATTTPSSADP
ESSGNFPSVAVEDRREIPEKVVAALPSWTPLNDPGMIPHRGSHSALQATIEATLPGGQES
SPAHQEPRILDTTYGGSSGNVLVAAKGGKTTCFESQLVTCDVQNSVSLSGCIQDYAPCLE
AFTGLEEGRASPKQGTNLPRALRRVELEAPSQQRVKRKESVGCGLAETCHGGSKHSRLTS
LPDQRPSPSPGGVQEEAQCRCPREASYCVVFLGNIEHSRTLSLSRGQEDNRTTPCHLCNP
KPIASLISFSPLSTLPGYRDGDLGKESSKAALHTLQPPCIMPSRISGMDERGESCSRELE
GLLAPGLEPKVIHREFGPTDSSTQEPSASAAVLSLVQGVSSPSAPGMRTSSLSHSVADGS
SRSVEDPEKEVAEKKPSTELETAFSSADMCSEPLRKFQGSSVGGQNTQESQTKPELPLTV
ERPHTLNLSEGSVESELPGEPQHGCLGNVIQHLPEKPQLSTEFRDHSGLGPQAKFVAKLK
HISRHQADGPWEEEGQQRDQALSGSKEPAQDRSSQPSHEGGLDGCQIRDAGTEEASTAKS
FVSKMFLTGFEDSATMPLGQSGAPRLTPQSPGLPASGREQPAPHHRCSLPVIAVFSGPKH
SRSSPRPQFSVVSSSRSLQELNLSVEPPSPTDEDIQEPNRLWSPHHRDYFSDESAVRTSL
KAEGCSQKASSNADNRTDNHWPPKPTTLPYPRSSALSCMPTPDFMASWTPRTLEESWQEN
LERPGSQARPEKWHSEADKKMLHFDSSDINPYILSSHPERPVQIGWKQYVFGSALDVSCG
QTPQGLIPSNKTRCSSMDKGLEHQNSPLYSHLSTHANARDLSSTHSSIGNAQGSCEAWGV
WGSSFALGNLHILNSPEGATPSKGADKRAQFWDTPDEVGCLRNDPLLAEGSAASPVDEIM
LLYPSEVGGPVGQSRINTLEQGTQTLGCSLHWSSTDISAQPETRAVPVSGLVSWTSMHNL
SLHLSQLLHSTSELLGSLSQPSVAEKEQNIKRETPDEVTQALMIDGYTQTTMDKGIQTDL
AFPPLHLQAPEAGPQEVSGVLEVLGSDIPIMFPQERGHVTHNLQKRETEEMTSKMARPSE
LQEESTHCRPQSLPASTSHVRFQKAHFGQNLPSVSPQAFPDASLPPSSQPEVPSCLAVGS
PSLSSSQSPEPCLSAAESVRDPQVEKGLGTIGTLLVDRASSPILTLSASTQRLGFPSDSL
SLTVPSACPPEGHQKLVSSPDLLLDTSRFPVVNNPQTTDESGGSQRVGALCGEGRSPLER
SDGRPFLKISSPDGLPQSPKLQVCLLEQPPQQLQPRTTTLIQSGLPPPSLRSQSQRLANG
LVPDDLASLECDPVSSRGPSRWQSKTEHGDESSASPVEPQPTLDFLSSREDLQPLIPCPV
SGLTEGSVHRALSTGLQGSALGPTEACQTEMLLCSGSQVCVAPEPQHHSLRDFPVHNRYT
HWCGVQDGSPVGLGLMESLGPRCDLSSGEQGQKPLQPPDDQSQGPHWSQREQIPLQVGAQ
NLSLSMELTEAKLHHGFGEADALLQVLQSGTGEALSAEEPVRSTWEELYARQKQTIETLR
RERAERLQNLHWMQIRPRKQLSLLPNRDLPTRDLDLPSRRREYLQQLRKDVVETTRSPGS
ASRSAHPASDIAVMLQEYQRAREEAKVEIALARDRLRERTEQEKLRIRQQIISQLLKEEE
KLHTLAMSNSLSTSSNGSLSSGVTSGYNSSTALPDQLQSPDSVGDINLLDCSDSWIGDVR
GSSTVRTSHLSLAGSAWKSLASGPRTSLGSGCCSPSSLSSLGACFSSSYQDLAKHIVDLS
IADVMAACSDNLHNLFSCQAAAGWNYQGEEQEVRLYYKMFSSTRHGFLGAGVVSQPLSHV
WAAVSDPTLWPLYHKPIQTARLHQRVTNSINLVYLVCDTTLCALKQPRDFCCVCVEAKEG
HLSIMAAQSVYDTSMPRPSRKMVRGEILPSAWILQPVTVEGKEITRVIYLAQVELGAPGF
PPQLLSSFIKQQPLVIARLASFLGC
NT seq 14118 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatgtgcgagtggccgtgagggttcggcccctcagcaagagggagatcaaagaa
gggggaagaattattgtggaagttgatggcaatgtggcaaaaatcagaaatttaaaggtg
gacagtcgaccagatggctttggagacttccgggagaagattgtggcatttggctttgat
tactgctactggtcagtcaacccagaggaccctcagtatgcatctcaggatgtggtgttc
caggatttggggactgaagtattatctggagctgctaaaggctacaacatatgccttttt
gcctatgggcagacaggctctgggaagacatataccatgttggggaccccaacctctgtt
gggctgacaccacggatatgtgagggtctcttcatcagggaggaggactatgccccactg
ccttcctcttgcaggataaaagtaagtttcctggaaatctataatgaacgagtgcgggat
ctactgaagcaatctgataaaaaaaagtcctactctctgcgggtcagagagcacccagag
ttggggccctatgtacaaggtttatctcaacatgtagttaccaactataagcaagtaatt
caactcttggaggagggaatagcaaacagaatcacagcagctactcatattcatgaggcc
agcagcagatcccatgccatcttcactatctactatacacaggcagtcctggagaacaac
ctcccatctgaaattgctagcaagatcaaccttgtggacctagcaggcagtgaaagagca
gatcccagttactgtaaggaccggattaccgaaggagccaatatcaacaagtctcttgtg
actctgggaattgttatctccaccttagcccagaattctcaagcattcagcagctgccaa
agcctcaacagtgcagccagtgatggtgacagtgggatccctagctctccttcagggacc
agcagtggagcagggccttcccggaggcagtcttacatcccataccgggactccgtgttg
acctggctgctgaaggacagtcttggaggcaactccaaaacaatcatggttgccactgtg
tctcctgcacacactagctacagtgagaccatgagcacactaagatatgcatccaatgcc
aaacacatcatcaacaagccacgggtaaatgaggatgcaaatgtaaaattgatcagagaa
ctcagggaggagattagaagactaaaagccatgctgctgaacttcgaactgagaaacttc
agtccactgaatgaggaaaaggatgagaatctgaaagaactggttctccaaaatgaattg
aagatagaccatctgactaaagactggacccagaagtggaatgagtggaaggcccttgtg
gagaattacagagtggacatcaacaggaggagggctggggtagtcattgactccagcctg
ccacacctaatggccttggaggacgatgtacttagcacaggtgtcgtgctctatcacctc
aaggaggggacaacaaaaataggaaggattgactcagaacaggaacaggatattgtcctg
caggggcaatggattgagagagatcactgcactatcaccagtgcctgtggggtagtcatt
ctgcggcctgcccgtggggcccgctgcacagtcaatggccgggaggtcactgcctcctgt
cgtctcacccaaggagcagtcataaccctggggaaagcgcagaagttccgattcaaccac
ccagcagaggccgctgtcctgcggcagagaaggcaggttggagaggctgtcggtggcagt
ggctctttggaatggttggacttggatggagatgtcactacctcccggttgggtattagc
cctttgctttggaagaaaaggagagtgctggaagagctgagtgacgaggaccaccagcca
ctgagggctggagaggcgccccacagagcccagattcagcagcagcactacgtgggggat
ttgaggcagcgaatcctagcgggacagattagagccaaacaggatctggagttggaccag
gcgcacatcagccggcaaattaaagacaaccagcagtggctgctcggagacgagatctgg
ctgaccggtttgcagcagcaagaccacgtagcagagaaagaactcaaggcctgtgtgcca
tctggtgcttggcttcagacagattctgagactcagctatccccactggtccgaagtcag
aagagggaagtgagactgcggcttgggtgcaggaacgcacttcgggtggcacagcgggac
atccggcgaagaaaggcctccttccagctagagagaatcaagaagcagaggctactggag
tcccagaagggactggagccatccaaagcatcgtgttggctccaggatgactgcacccaa
aagcccccatactgggtacccagcactgatgccatgctcccaggacctcaacatagaagc
cgactgccaggttgcagttctttgagcctccgagggctctgcagctggtactttccccag
ctacacagtattttcctgaatcgggatccctccaccatgcctgaccctactgaccaaata
tcagagaaaattccatcagaagagtatttcccccaggctgctgcttaccctccaaggaca
ggacacttcagtaagaatgcccactgttcttcaggcagggggcctctctgcactgccagg
ggggccttggcaaggaaaggagcctcagtctcaggcacctgcctcactgtgagttctgag
tctgccagcatccaggaaatggaaagagcgggtaagcagccctgtcggatggtgtctcag
agcttagcatctctggatcattcagttaacaagctaaagccaagggataataagccagtt
gcactcactccctccacctatatcaggtggggtaggggactagcagactctgaccacaca
cgagctgagtggcaaaaagaagagaaccttggaacccacaagactgctaaaggagcctgt
tgcagttcctcacaaccctgtggacccaaacaggcatctgggcatggaaaggcagccgag
attttctgggtggaatccaaaccaccttctcaaagcagggcatcaaaaaggcagcagagg
gtgctggtcaaagacattgtaaaaaagtcctcttgtttgcctcatggcagcccattgagg
aggcaataccacgtgggagacccagattccacatcctcactcacagattccagcccaaga
gttgatcatataagagatagaaatggggacttatctgatacaaatagcaggtactcagtg
gattctctctcctgtgtctatgccaaagccctaatggagccactgaagccagaggacccc
caggggaaggaacagggtcttccagagccagagaattctgaaagtgatgacagccaaata
tctgaggactcgctggctgagaaggggtatgaaagcccaccagacaacccagggagcagt
tacctccccagtggtcatggccaccccaggaccagagttatggcctctgtgaggggcttt
accacatcctcaaacagtggactattcacccaaactcacaggagcttttccctggatagc
ctgattgatgccaaggaggagctgagggaagaacagcaagaagagggtttcttcagttca
gctgacgagatgcccacagagactttttggcacctacagacctccagtctgcccatagta
gaacaggaggcaatgtgtagacttggtcccatcagcaatggaacggtagccaggctggat
gccatcctgccaatgagcagttcattttaccttggtcccccgccccaacccccctgtgag
caacctgagtcagaggtagaggcaagctcctctgaacagacaaacatgctccaaggcctg
cagctttcaagagggagtcctctgttgtccatggattcctggttttcctgtgactctaag
ataaattccagtagcccctcaggaatagtgggttctttatgtccaagtcctgatgtccag
gaatctcagccccatggttgggagaggcctggacatgggcaaaatatagaagaactaaag
ccatcaggggcagaaatactcctgccctatacctccaaactaccccaaggtggtactgag
ctgccctgctgtgtaagaggtgtgtacacaatccctgcttctgatacatccaagctatca
ttttgggggtctcataggcttcttcagccacgagttgctggcatcttccaggccagaggt
atccctgacacagcccaggaaggcaactctgaagcatccaacaactccagtgtttcaagt
gttttggctgcctctgctgcctcattcactcatgtaggcagtacccacgagagggactgg
ggtgcccttcagcaaaagtacctccctgaactgtcccatcccgtgttggaggctataaga
gaatccaggccaactttctcctcccttgaggaagactctgcttccttgacacaaggttct
ggcaaagaaacagatacgctgttgccagttggttctggggtatctagcagtctggatttc
agcaactttcctgtccatttatccaaaattcagtgtttgagagcagagaaagaacaggac
agtttgagtgcagagctagaaggtacttcagatttctttacaattagagagaaagaggtg
agtcatagtggaacttactcagcagatgtagaatcattgacttctggaactacaaatgtt
gtaccagtctttgcagcagagagcaagatggcaaattccatgagagaagtatgtcaagtc
aagcagaacaacttggaagagtcttctcagagtagtggaaagcctcagaggatgagttcc
tctgatgaatgttttttcttgaaaagtccttgtcacagtaatatcaccatagtcagtaaa
gaaaaccactggccccagggctgggctcctcccatgaagaatagtgcagcccaggagggg
cagttaagtcaccctggctacccgcccctgcaggaagagaaggtagactatcaggaaagc
tccagggaagtggttagaaggcacccaagtgtttcgtttgcatttctgtcaggtccaaag
atgtacccccactctggtgcctggaatccactcccatcttccttgcagccacctcccttg
gagacattctatgtgaccaaaagccgggatgccctgacagaaactgccttagagatcccg
gcttgcagagaatcaagagtgccttccccatcccccagagaagcctggggctttggtcat
gaccaccaagttctccaaaatatttattttaagaataattttccagtgctgttacaaaac
cagaattccaagactgcctcatctcaacaggtcacagcaggaaggccagttgatctgaac
accaaggaagttagcagagaaagagggaagtgccctggaaacattgaagaagaaagccat
aattcagtttatttttttgttgctcagaacaaacattttctttcatctactagcacaaaa
gtatgtgaatttgaaaatcaagttggaattttaaataatcacaatctttcagcacttaag
gagagagaaaaggccactgtacagtcctgtttcaatgtttgctcaagccattctaggtct
aggaaacctctccttgtttgtgagtctgaggcagatggggaagaagagcaggatcacaat
gtagttctaagacagacccaggccttagatatgaacagacagtttccttctggggccagg
tctgatttcatctatgaaaccatcaatttagcccttgacaacgatatgctgggggaagct
gctatttctttgcagtccagatcagtacatcatagagtaagtggtccaaagataatggcc
ccagatgagagtccagcccacaagggtgagaggaaaaatgaatctgggcttcttgggaaa
gctttccatcccaaagatagctcaaaagagtttaagcatccaaagacagagtctatatat
gaaagattccagtcagttacatgctctcaggaaaaaaacctgaatgaatccaaaggcccc
ggaaggtcagaagaaatgttaagccccaaagaagaaccttctggaaagaaacagaataaa
agagttaacagtggtgatgaaatggccaggctaattaggagtgtaatacagctggaagat
ggcatcttggaaattgaatccaagcagaataagcagctatctgcttcccaaacactggga
gtcggtaaggagtttgtgttctgggaccagagggaccaggagatggctgactatgtcctg
aggccaagcagctttggaaactacgtgtctttgaaggatcagccatcttctccaaaacag
acggatgacgttacctttagggatagtgaagctagagaaatggaggttgacagtagcact
ggggaaggtctccaggcccagaaaatcaccttgagcccctttaggtcaagggaatgtata
caagacactaagtttgcaaaagaggacacttgcccagctgtattaaacagatcctccagg
gacacttgtgattatgtaaggacatgtacagtttgtagagagttcacagacacttgtgct
aatccaagaaccaaagcactggctagtgctctgccactgcagcccagccccaagatgtct
tctgagaaggagagtgaggcagagaatgcatctgcaagcccccccacaaggcagccttgt
ggcttgggaagtcttgaggaactggaaactgtgaaagatttttgggaaacccaagttgcc
aagtgtataagtagttctaaacaagaggagcctaaagttcaaggtagagttgaagaaatg
gctgtgcgaagaggagggaacctacaagaggaaaatacagtggtttcactgattcagcaa
cttcctagcccaagccagtgctgtatcggcacatcttccagccaggagattggtccattg
ctgagccagccagatttctctgaggctcctcacggaaacctgcatagttccttgcccttg
aattctccaaggctgccaagagactgtcttcatgtacacgatactgtaggcatctcttca
gttgactatgtactggatcccacaattttgaaaatacctaacagtcccttggtaactgga
gcagaaagtcaggacctgtgtggcgagccccaaagccatagccctcagggaactattaga
gagggctcctcctcggcacactctgcttggtgtgggtctgtgatatccacgtccatgaga
tctcatggtcaattctgtgtatcagagaacattcccctgggggcagagggcaagagatca
gtaagtacccaagaccaaggaggggacctcagaagcatcttgatgggcttgagttccaga
gatggttttgcttctgaagctgaggcagctgtacagagaggaacagaaagagccacttcc
ctgaacagggcctctagcccacttgaaaagaaggccagctgcctcttagaagagggtaac
agtcaaggctgtccggcagaggaggctgaggatctctatcttcctagtggtacattctca
gcacctgtgtccctgccaaggatgcctctcccagagcgctgtgctcatacatccatgggc
ttgggtgtgttggaagagatcacacaagcacaagccgagggaaagcagcttcatgacttg
ggggctggaggcaatattcttccatactatgagactttactaggacctgaatgttcttca
ggggtcactgaccagtcgttgtcagataggaccagaaatgaggctgaagcacaaagattt
catgtagcctctctctctgctgaaccaggacatctattgactaatgagaggaaagtttct
caggccacacccctccctgcagacagctttcaacatctgcccagcacagagactcacata
gtcccacagcctacctcacagatttcctcccatgtagccccaactctaggaaaaagctat
tgttctggagaattgagactttttctgggagctggtgaacagttggtatgtcactccagt
tcttctggaatcatagagaaaaagaaaaaagcaaccacaacaccttcctctgctgatcct
gagagctcaggcaattttccttcagtagctgtagaggacaggagggaaataccagagaaa
gtagtggctgccttaccttcttggacccctctgaatgaccctggcatgattcctcacagg
ggaagccattcagctctgcaggcgactatagaggccacgctccctggtggtcaggagagc
agcccagcacatcaagaacctagaattctagataccacttatggaggaagttcaggtaat
gtcttagtggctgcaaagggaggaaaaacaacctgttttgaaagtcagcttgtgacctgt
gatgttcagaattctgtcagcctttcagggtgtatccaagactacgctccatgccttgag
gctttcactggcttagaagaagggagggcaagtcccaaacagggtaccaacctgcctaga
gctctgagaagggttgaactggaagctccctcacagcagcgtgtgaagaggaaggagagt
gttggctgtgggctggcggaaacctgccatggtggcagcaaacattctagactgacttca
ttgccagatcaaagacctagcccaagtcctgggggagttcaggaagaagcccagtgcaga
tgcccacgggaagcttcatactgtgttgtcttcttagggaacattgaacacagcaggact
cttagtctatctagggggcaggaagacaacagaacaactccttgccatttgtgcaatcct
aaacccattgcttctcttatctctttctccccactctccactttaccgggttatagagat
ggtgacttgggaaaagagagttccaaggctgccctccacactctccagccaccctgcata
atgccttccagaatcagtggaatggatgagagaggagaaagctgttccagggaacttgaa
gggctcttggcacctggccttgagcccaaggtcattcatagagaatttgggccaacagac
agcagcactcaggagccttctgcttctgctgctgtcctatctctggttcaaggagtcagc
tccccttctgcccctggtatgaggacaagttcactgagccactcagtggctgatggaagc
tcaaggtcagtagaggatcctgagaaagaggtagctgagaagaaacccagcacagagctt
gagactgccttttcctctgcagacatgtgctctgagccactgaggaaatttcagggcagc
tctgtaggtggccagaatacacaagagtctcaaaccaagccagaactacctttaacagtg
gagagaccacacaccctgaatttaagtgaaggatctgttgagagtgagcttccaggggaa
ccacagcatggatgtttaggaaatgtaatccagcatcttccagaaaagccacaactttcc
actgaattcagagatcacagtggcttgggtccccaagctaagtttgtagcaaagttaaaa
cacatctccaggcaccaagctgatggtccttgggaggaggagggtcagcagagagaccag
gctttgagtggtagtaaagagcctgcccaagacaggagttctcaaccttcccatgaaggt
ggcttggatggctgtcagattagagatgcaggcacggaggaggcatctacagccaagtcc
tttgtgtctaagatgttcttgacaggcttcgaagattcagccaccatgcctttgggacaa
agtggagccccacggctcacaccccagagtcctggcctgcctgcctctggcagggagcag
ccagctccccaccacaggtgctcacttcctgtgattgcagtcttctctggccccaaacac
tccaggtcctcccccagaccacagttctccgtggtcagctcttcccggtctcttcaggag
ctgaatttgtctgtggagcccccttcccccacagatgaggatatacaggagcctaacaga
ttgtggtctccacatcacagagactatttctcggatgagtcagcagtgagaacatctctg
aaagctgagggctgcagtcagaaagcctcatctaacgcggacaataggactgataatcac
tggcccccaaaacctactacccttccttacccaaggtcatcagctctttcttgcatgcca
acccctgatttcatggccagctggacacccaggaccctggaagagtcctggcaggaaaat
ctggagagaccgggtagccaggcgaggcctgaaaagtggcactccgaggcagacaaaaaa
atgttacactttgactccagtgacatcaatccctacatcctctcctcccatccagagagg
cctgtgcagattggctggaagcagtatgtgtttggcagtgcattagatgtctcctgcggc
cagacaccccagggcctgataccatcaaacaaaacgcgttgttcaagcatggacaagggc
ctagaacatcagaactctccactgtactcccacctcagcacccatgccaatgcacgggac
ctgtcgagcacacacagcagtattggaaatgcccagggttcatgtgaggcctggggagta
tggggttcctcatttgccttggggaacctccacatcctgaacagccctgaaggagcaacc
cccagtaagggtgctgacaagagagcccagttctgggacacccctgatgaagtaggctgt
ctgaggaatgatcctctcttggctgaaggaagtgcggcaagtccagtagatgagattatg
ctgctgtatccatcagaggtgggtggccctgtgggacagtccaggataaacaccttggag
cagggcacacagaccctggggtgcagtctccactggagctccaccgacatctctgctcag
ccagaaacccgtgcagtgccagtttctggtctggtctcctggactagcatgcataatctc
tctctccacctctcacagctgctgcacagtacctcagagctgttggggagtctctctcag
ccaagtgtggctgaaaaggagcagaacatcaagagggagaccccagatgaagtgacccag
gcccttatgatagatggctatactcagaccaccatggacaagggcatccaaactgacctg
gcctttccacccctgcacctccaggccccagaggccggccctcaggaggtcagtggggtc
cttgaagtgctgggctcagatattcccattatgttccctcaagaacggggacatgtcacg
cataaccttcagaagagagagacagaggaaatgacatctaaaatggcaaggccctcagaa
cttcaggaagaaagtacccactgcaggccacagagccttccagcatccacatcccacgta
aggtttcagaaagcccactttgggcagaacctcccttctgtgagccctcaggcctttcca
gatgcctccctgcctcccagctcccagccagaggtgccctcctgcctggccgttggcagc
cctagcctcagcagctcccaatccccagagccctgcctcagtgctgcagagtctgtcagg
gatcctcaggtcgagaaggggctgggcaccattggtacattgttggtggacagagcctcc
tccccaattctcacacttagtgccagcacccagaggttggggttcccctcagactcttta
tctctcacagtcccctcagcttgtcctcctgaaggccaccagaagcttgtctccagccca
gaccttctccttgacacctctaggtttccagtggttaataatcctcaaactactgatgag
tcaggtggctcccagagagtgggggctctatgtggggaaggcagaagtcccttagaaagg
agtgatggcaggccattcctcaagataagctccccagatggcctaccgcagagcccgaaa
ctccaagtttgtttgttagagcagccgcctcagcagcttcagcccaggacaaccaccttg
atccaaagtggactgccaccaccctcactgaggagccagagccagaggctggccaatggc
ctcgtgcccgatgacctggcttccttggagtgtgacccagtgagcagtagggggccaagt
cgatggcagagcaagacagaacacggggatgagagttcagcatctccagtggagccacaa
cccactctggattttttgtcttcaagggaagacctccagcccctcatcccttgccctgtc
tctgggttgactgagggctctgtccacagagccctgtccacagggctccagggttctgct
ttgggcccaaccgaggcctgccaaactgagatgttgctgtgctctggttcccaggtgtgc
gtggcccctgagccccagcatcacagcctgagggacttcccagtgcataacagatatact
cattggtgtggggttcaggatggctcccctgtggggctaggcttgatggagtcactgggg
cccagatgtgatcttagctctggagagcagggacagaagcccctacaacctcctgatgac
cagagccagggtcctcactggtcgcagagggagcagatccccctacaagtgggggcccag
aacctctctctcagcatggagctcacagaagcaaaactgcaccacggctttggggaggca
gatgccctgctgcaggtgctacagagcgggacaggggaggcgctctctgctgaggagcct
gtgcggtccacctgggaggagctctatgcccggcaaaaacaaaccattgagaccctccgg
agagagcgggctgaacgacttcagaacttgcactggatgcagatcaggccccggaaacaa
ctgagtctcctgcccaacagggatctccccacccgggaccttgacctacccagcaggcgc
cgagaatacctgcaacaactgaggaaggatgttgtggagaccaccaggagcccagggtca
gcatcacggtctgctcaccccgcctctgacatagcagtgatgctgcaagaataccagcgt
gcccgtgaggaggccaaggtggagattgccctggcccgggaccggctacgggagaggact
gagcaggagaagctgagaatccgccagcagatcatctcccagctgctaaaggaagaagaa
aagctgcacaccctggccatgtccaactccctgagtaccagctccaatggaagcctctcc
tctggtgttacctctggctacaatagcagcacagccttgccagaccagctccagtcccca
gacagtgtgggggacataaacttgcttgattgcagtgactcctggataggggatgttcgg
ggcagttctacagtgaggaccagtcacctgagtctggctgggtccgcctggaagagctta
gcttctggccccagaacctccctaggcagcggctgctgttctccgtccagcctgtccagc
ctgggggcctgcttctcctcctcctatcaggatttggccaagcacatcgtggacctctct
attgctgatgtaatggctgcttgctcagataatctgcacaacctcttcagctgccaggca
gcagctggctggaactatcagggtgaagagcaggaggtacgactttactataagatgttt
tcttctactcggcatggcttcctgggggcaggcgtggtgtcgcagccactatctcacgtg
tgggcagctgtgagtgaccccaccctgtggccactataccacaagcccatccagacagca
aggctgcatcagcgagtgaccaatagcatcaacctggtatacttggtgtgtgataccacc
ctgtgtgctttgaagcagccacgggatttctgctgtgtctgcgtggaagccaaagagggc
cacctgtctatcatggcagctcagtctgtttatgacacatccatgccgagacctagcagg
aagatggtccgaggggagatcctgcccagtgcctggatcctgcagcctgtcactgtggaa
ggaaaggagatcaccagagtcatctacttggcccaggtagaacttggtgcaccaggcttc
cctcctcagctcctaagctccttcatcaaacagcagccgctggtcatagccagactggct
tccttccttggttgttag

DBGET integrated database retrieval system