KEGG   Canis lupus familiaris (dog): 488922
Entry
488922            CDS       T01007                                 

Gene name
VCAN
Definition
(RefSeq) versican core protein isoform X1
  KO
K06793  versican core protein
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    488922 (VCAN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:cfa00535]
    488922 (VCAN)
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    488922 (VCAN)
   04091 Lectins [BR:cfa04091]
    488922 (VCAN)
Proteoglycans [BR:cfa00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   488922 (VCAN)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   488922 (VCAN)
Lectins [BR:cfa04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   488922 (VCAN)
SSDB
Motif
Pfam: Xlink Lectin_C V-set EGF hEGF Sushi ig I-set EGF_2 EGF_CA
Other DBs
NCBI-GeneID: 488922
NCBI-ProteinID: XP_003434465
Ensembl: ENSCAFG00000008582
VGNC: 48241
UniProt: F1PGL1
Position
3
AA seq 3401 aa
MLINIKSILWMCSTLIAAHALHKAKVEKSPPVKGSLSGKVNLPCHFSTMPTLPPSYNTSS
EFLRIKWSKIELDKNGKDLKETTVLVAQNGNVKIGQGYQGRVSVPTHAEVVGDASLTMVK
LRASDAGQYRCDVMYGIEDTQDTVSLAVDGVVFHYRAATSRYTLNFEAAQKACLDIGAVI
ATPEQLYAAYEDGFEQCDAGWLSDQTVRYPIRAPRVGCYGDMMGKEGVRTYGFRSPHETY
DVYCYVDHLDGDVFHITAPNKFTFEEAEEECENQDARLATVGELQAAWRNGFDQCDYGWL
SDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKQNISEATTIE
LNILAETASSSFSEELHMVPDRTTPVIPLITELPIITTKFPPVGNIVNFEQKTTFQAQAI
THGVATESSTPAGSTMKPGDMDYYPPSGSGPLGKADIPEIQKEVPQSTTVVSHHATESWD
DVWEDIQTQESVTQVEQIEVGPLVTSMEVFKHVPSKELSVTETPFVSTTMTLESKTEKKT
VITVSESVTTSRYGFTWGEDDSEDSTDTVRSTQSTLAFSQVPEVVTVSKTSEDTASTPPE
DREQVSASTILSPVTVPDSDGSSTDTWEEKQTNGRKTEDVFGPYASTTPFPSQHHTEVEL
FPYSGDKKLVEGIPTVIYPSPRTEMAQGRERTETLSPEMRTDTYTDDEIQEKITKDPFIG
KIEEEGFSGMKFSTASSEEIHLTESSVEMTKSFDSPTPTTAKLSVVPTEARDIEEDLTTP
AELETDGYQDTTKYDEGVTTVPLSHSTVSVEVVTVSKWAWDEDDTTVKPLESTEDAGPPK
LPPALLTTTEVSGKDKEIPSFTEDVGDEFTLVPDSTQKPLEEFTEEDSTDHGKFTVGFQP
TTLIGISEKPTLRDSTPEERVPPVTSVEGQVIYAATEGSALDEEAMDVSEPVSTISQFVH
TSDVEGLAFVNYSSTQEPTTYVDSSHTIPLSVIPKTEWGVLVPSVPPEDEVLGEPSQDIH
VINQTQLEATLSPETIRTATEATRGTSPEEFPWKEQTTEKPVPALSSTAATTKEAATPVG
KEESDRTAYTVSEDRLVTASERAPGLETTPVGKIEHAMSHPPGAVTEHKAETDEMVTRTP
SIGPTVSLSPEPEQKHETESASPGAFVSPYSTHITQIIEETTTEKREKTSLDYTDLGSGL
FERPVATELPEFSTAKATVPSDFTAAFSSVERLHTTSASKPSSAPTEKPPLIDREPGEET
TSDMVIIGESTSHVPPTTLEDVVGKETETDIDREYFTTSSTPSATQPARPPTVEGQEALR
PQALSTPEPPAGTKFRPDINVFVIEVRENKTGRMSDLSVIGHPIDSESKEDEPCSEETDP
EHVLSLPELIEITLYHSEEDEEEDEECTNATDVTTTPSVQYINGKQLVTTVPKDPEAAEA
RRGQFESVAPSQNFSHSSESETHPFVVAENGLSTAVQPNESKETTESLELTWRPETYPET
PEHFSGGEPDVFPTVPFHEGEATDGPESTPERGLELDNLVHEPIEHVPLFSEESSGDAAT
DQESQKMISSKATEVTFGEEAEKSTSVTPAPNVVPSSVLADVSEDVSVTFTRNVLLHGPL
STVESWVEMAPQENVELSGSPSIPFPEGSGETEEDTNTMFTVATDLSQRNITDTLVTLAT
SKTTITESLSDIPATTFHSSSQQPSTEVAPTKFVGETDTPEWVFRPPLEGKRRKEEEEEG
TTGTASTEQVHVSTQRSDQLILPSDLESSSEVTSSHSASATWNSLMSSTKPTQPEKAMTS
SALVSTETSVLDHLGAQTAKPSSSSQSGFQEGLSTLPGRPISFSLEPGSGEAAADPETAT
VASFSLNLESGIPTEKEAAGTLSPHVETIFPFEPTGLVLSTVMDREVAEITSQTFKENLI
SEVSGEQNHGPEIKGFSTDFPLEEDFSGDFREYSTVTYPTEEETVMMEGSGDAASKDTQI
SSSVVPASDHSNHRADPEGPSSTSVSTSAFPWEELTASAEGSGEELVSASTSVDHVFPST
MGNASGTDSPFIDQGLGEEGAINDANKRSTVLPTAEAEGTEAATTEGEVRVDGTVSVTFP
QTMEPAKLWSLQEINPVQQGTESETASEEEIEEPNSFESPQSSVAPEQINFDSQTFTETG
LRTTDYSTLTMKRTDSIGEEMEKEGISFTDVSTPDPDAKGLGPYTALPEVTEKSHLFLAT
TSVTESVSAESVVTDSPVEKEETIKPFPKVVTPIIKEADTDLLFSGLGSGEEVLATTVPV
NFTEMEQIMSTLYPQVSQMESSETSHISNTTEDYEGMENVAHEVGPPISKTDSLSEDSET
ASSTTLLEIVSDTTTAGPSTAPLTFSTDAEHPQHETHGWAEEIQTSRPQPMTEPVSNENS
PTAETKETATPPSDFLARTYGLEMAKGFVTSAPKPSDLLYEHSGEGSGELDMVDLVHTSG
TTQASRQGSTTFVSDRSLEKHPEVPSAKAVTVDGFPTVSVLLPLHVEQNESSPAPTSTLS
STRSYERSTEGAADSFQDHVKGFEDSTVKPNRRTTTENIIIDLDKEDKDLILTITESTIL
EHLPELTSDKNTIIDIDHTKPIYVDILGMQTDIDPEVLAGPHGSSEESAQVQEKYEAAVN
LSLTEENFEGSGDTLLANDTQTTHSESMPSEDRSRLDHTGFIFTTRIPVPSTETELDIWL
PTATSLPIPSPSATVTPETEEPKSEAKALDDTFESSTLSDGQAIADQSEVISTLGHLEPR
DEYEEKKYVAPSFQPEFSSGAEEALIDPTPYVSIGTIHHMAQSLTEAPNVIEGSNPSDDT
DTTSAASAFAKLSFQTPSSPLTGYVGSGASEQAEGPQAGAVPGTDAGMAHGSPGKLADTE
VTFTSSSEEPFHITEPPSLSPDTGLEPSEDESNPKLLEPTEASPTKPTAEEGTEILQGSQ
TQTNIQLSGETMKNHVRTPEAGTVVTTAGEIKLEGATLWPHSTSASAVYGVEADVMPQPS
PQTSERPTVPSSLEINPETQAALIGGEDYTVAASDQQVSARILDSNNQATVSIAELHTEL
ATPSFSLLETSNETGFLIGINEESVEGTAVYLPGPDRCKTNPCLNGGTCYPTETSYVCTC
VPGFSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHK
FQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEH
DFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVA
CGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAMPKITCMNP
SAYQRTYSKKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR
NT seq 10206 nt   +upstreamnt  +downstreamnt
atgttgataaatataaagagcatcttatggatgtgctctaccttaatagcagcccatgcg
ctacataaagccaaagtggaaaaaagcccacctgttaagggctccctgtctggaaaagtc
aacctaccttgccatttttccactatgcctaccttaccgcccagttacaacacctccagc
gaatttctcagaatcaaatggtctaagattgaattggacaagaatggaaaggatttgaag
gagactaccgtccttgtagcccaaaatgggaatgtcaagattggtcagggctatcaagga
agggtgtccgtgcctacacatgctgaggtggtgggtgatgcctccctcaccatggtcaaa
ctgcgtgccagtgacgcgggccagtaccgctgcgacgtcatgtacgggattgaagacaca
caagacacggtatcgttggcggtggacggggttgtgtttcactacagagcggcaaccagc
aggtatacactgaattttgaggctgcacagaaggcttgtttggatattggagcagtcata
gcaaccccagagcagctctatgctgcctacgaagatggatttgagcagtgtgatgcaggc
tggctgtctgatcagaccgtcagatatcccatccgggctccccgagtaggctgttacgga
gatatgatggggaaggaaggagtcaggacctacggattccgttcgcctcatgagacttac
gatgtgtactgctacgtggaccacctggatggtgatgtgttccatatcactgctcccaat
aaatttacctttgaggaggccgaagaagagtgtgagaaccaggacgcccggctggcgaca
gtgggggaactccaagcagcttggaggaatggctttgaccagtgcgattatgggtggctg
tccgacgccagcgttcgccaccctgtgactgtggccagggcccagtgtggaggtggtttg
cttggggtgagaaccctgtatcgttttgagaaccagacaggcttccctccccctgatagc
agatttgatgcctactgctttaaacctaaacagaatatatcagaggctacaaccatcgaa
ctgaatatccttgcagaaactgcatcatccagtttttctgaagaactacacatggtaccc
gacagaacaacaccagtcatccctctaatcaccgaattacctatcattacaaccaagttc
cctcctgtaggaaatatagtcaattttgagcagaaaaccacatttcaggctcaagctatc
acacatggagtagccactgaatcgtccacccctgctggtagtaccatgaagcctggggat
atggactactacccaccttctggttcaggaccacttggaaaggcagacatacctgaaatt
cagaaagaagtgccccagagtacaactgttgtctcccatcatgctacagagtcatgggat
gatgtctgggaagacatacaaacacaagaatcagttacacaagttgaacaaatagaagtg
ggtcccttggtaacatctatggaagtcttcaagcacgttccttccaaggaattgtctgta
actgaaacaccatttgtgtctacaacaatgaccctggaatccaaaactgaaaagaaaaca
gtaatcactgtttctgaatctgtgaccacaagccgctatggattcacgtggggagaagat
gacagtgaagacagcacagatacagttagatctactcagagcaccttggcctttagccaa
gtacctgaagtcgtgacagtgtcaaagacttcagaagataccgcctccactccaccagag
gacagggagcaagtctcagcatcaacaattctttcacctgtaactgtgcctgacagtgat
ggatcatccacagacacctgggaagagaaacaaactaatgggaggaaaactgaagatgtt
tttggcccttatgcatccactacacctttcccgtcacagcatcatacagaagtagaattg
tttccttattctggtgataagaaattagttgagggaatacccacagttatttatccctct
ccacgaacagaaatggcgcaaggaagagaaagaacagaaacactaagtccagagatgaga
acagatacttataccgatgatgagatacaggaaaagatcaccaaagacccatttatagga
aaaatagaggaagaaggcttctctggaatgaagttctctacagcttcctcagaggaaatt
catcttacagagtcttcagtggaaatgaccaaatcttttgattccccaacaccgacgacg
gccaagttaagcgtagtgccgacagaggcaagagatatagaggaagacttaacaacaccg
gctgaattagaaacagatggctatcaagatactacgaagtatgatgagggtgttacaaca
gtgcctttgagccacagcactgtaagtgtggaggtggtcactgtatcaaaatgggcatgg
gatgaagatgatacaacagtaaagcctttagagtccacagaagatgcaggccctccaaaa
ttgccccctgccttacttaccactacagaagtgagtgggaaggataaagagatcccaagt
ttcactgaagatgtaggggatgagtttactcttgtcccagatagtactcaaaagccatta
gaggagttcactgaggaagactccacagaccatgggaagttcacagttggatttcagcca
actacattaattggtatttcagaaaagccaactttgagagattctacacctgaggaaaga
gttccacctgtcacaagcgtggaaggccaagttatatatgccgccacagaaggaagtgct
ttggatgaagaagctatggatgtctctgagccagtatctactatctcccaatttgtacac
acttcagatgtggaaggattggcgtttgttaattatagtagcacccaagaacctacaact
tatgtagacagttcccatactattcctctgtctgtaattcccaagacagaatggggagtg
ttggtaccttctgttccgccagaagatgaagttctaggtgagccctctcaagacatacat
gtcattaatcagactcagcttgaagcaactctttcccccgaaactataagaacagcgaca
gaagctacacggggaacaagtccggaagaattcccttggaaagaacagactacagagaaa
ccagttcctgccctcagttctacagctgccaccaccaaggaggcagcaacacctgtgggt
aaagaggagagtgacaggacagcgtatacagtctctgaagacagattggtgacagcttcg
gagagagccccaggtttagaaacaactccagttggaaaaattgagcacgctatgtctcat
ccacctggtgctgtcactgagcacaaagcagaaacagatgaaatggtaacgcgaacacca
agcatagggccaacggtgtctttaagtccagaacctgaacagaagcatgaaacagaaagt
gctagtccaggggcatttgtatcaccttacagcacccacattacccaaataatagaggaa
actactactgagaaaagagagaaaacatccctagattatactgatttaggctcaggatta
ttcgaaaggcccgtagccacagaactcccagaattttcaacagctaaagccacagttcca
agtgatttcacagctgccttcagctcggtagaaagactccacacaacttcagcatccaag
ccatcctcagcacccactgagaaaccacctttgattgacagggagcctggagaagaaaca
accagtgacatggtaatcatcggagaatcaacatcccatgttcctcccaccacccttgag
gatgtcgtgggaaaggaaacagaaacggatatcgatagagagtatttcacaacttcaagt
actccatctgctacacagccagcaagaccacccactgtggaaggccaagaggccttgaga
cctcaggcactttccactccagaacccccagcagggacaaaattccgccctgacataaat
gtttttgttattgaggtcagagaaaacaagacaggtcgaatgagtgatttgagtgtaatt
ggtcatccaatagattcagagtctaaagaagatgaaccttgtagtgaagaaacagatcca
gagcacgtactaagtttacctgagttaattgaaataacattgtaccacagtgaagaggat
gaagaggaagacgaagagtgtaccaacgccaccgacgtaacgaccaccccatcagtgcag
tacattaatgggaaacagctagtcaccaccgtgcccaaggacccagaagcagcagaggca
aggcgtggccagtttgagagtgtggcaccttctcaaaatttttcacatagcagtgaaagt
gaaacacatccatttgtggtagccgagaatggattgtctactgccgtgcagcctaatgaa
tcaaaagaaacaactgagtcgcttgaactgacctggaggcctgagacttaccctgaaact
ccagaacacttttcaggtggtgagcctgatgttttccccacagtcccattccatgaagga
gaagccacagacgggccagagtcgaccccagagagaggccttgagcttgataatctggtc
catgaacctatagaacatgtacctctgttttctgaagagtcctcaggagatgctgctact
gatcaggagtctcaaaaaatgatctcttcaaaggctactgaggtgacatttggtgaagag
gcagaaaaaagtacttcggtcacgcctgctccaaatgtagtcccaagttctgtgttggca
gatgtttcagaggacgtatcagtcaccttcacacgaaatgtcctccttcatggcccattg
tccactgtagaaagctgggtagaaatggcccctcaagaaaatgtagagctctcggggagt
ccttcaattccattcccggaaggctctggggaaacagaagaagatacaaatacaatgttc
actgtggcaactgatttatcacagagaaatattacagatacgctggttactttagccact
agcaagaccacgatcacagagagtctttctgatattcctgcaaccacctttcattccagt
tctcaacaaccttccacagaagtagcaccaacgaaatttgtaggggaaacagacacacct
gagtgggtcttcaggccacctcttgagggaaagagaaggaaagaggaggaggaagagggc
accacaggcacagcttctacagagcaggtacatgtatccacacagagatcagatcaattg
attttaccctctgatttagaaagctcgagtgaagtgacatctagccattcagcctctgct
acctggaacagtcttatgtcctccacaaaacccacacagcctgaaaaggcaatgacaagt
tctgctcttgtctccacggaaacaagtgttttagaccatctaggggcacagactgctaag
cccagcagtagcagtcaatctgggtttcaggaagggctgtccactcttccgggtaggcct
atctctttctctctggagccaggctctggagaagctgctgctgacccagaaacagccact
gttgcttcattttcattaaatttagagtctggaattccaaccgaaaaggaagcagctggc
actttgtctccccatgtggaaactatattcccttttgagccgacaggattagttttgagt
actgtaatggacagagaggttgctgaaattacaagccaaacattcaaagaaaacttgatt
tcagaagtctcgggagaacaaaatcatgggccagaaataaagggcttttctacagatttt
cccttggaagaagatttcagtggtgactttagagagtactcaacggtaacttatcctaca
gaagaagaaacagtaatgatggaaggctctggggatgcagcatctaaagatacccagatt
tcatcatctgtagtacctgcttcagatcatagcaaccacagagctgacccggaaggacct
agtagcacctccgtcagcacttccgccttcccttgggaagagttgacagcctcagctgag
ggctcaggtgaggagttggtctcagcaagcacttctgtggaccacgtgtttcccagtacc
atgggaaatgcttctggtacagattccccatttattgaccaaggattgggagaagaaggt
gctattaatgatgccaataaaaggtccaccgttttaccaaccgcagaagctgaaggtact
gaagcagccacaaccgaaggggaagtgagagtagatggcacggtttcagtgacctttcct
cagactatggagccagccaaattatggtccctgcaagaaatcaaccctgtacagcaggga
actgaaagtgagacagcatcagaggaagagattgaagaaccaaactcttttgaatcccct
caaagctctgttgcaccagaacaaataaattttgattcacaaacctttactgaaactgga
ctccgaaccacagattattctacgctaacaatgaagagaactgacagtattggtgaggaa
atggagaaggaaggcatttccttcactgatgtgtctactccagatccagatgcaaaaggc
ttgggaccctatactgctctccctgaagttactgaaaaatcccatcttttcttagctact
acctcagtgactgaatctgtatcagctgaaagtgtagtcacagattctccagtcgaaaag
gaggaaactataaaaccttttcccaaagttgtgacgccaataattaaagaggcagacact
gatcttttattctctggactgggatcaggagaagaagttttggccactacagtgccagtg
aattttactgaaatggaacaaatcatgagcacattatatccccaggtttctcaaatggag
agttcagaaaccagccacataagcaatacaacggaagactatgagggaatggaaaatgta
gcacacgaagttggaccacccatctccaaaacagacagcctctctgaagatagtgagaca
gcatccagcacgaccttactagaaattgtaagtgacaccacaactgcaggaccttctacg
gcacctctcactttctccacagatgctgaacatccccaacatgagactcacggttgggca
gaagaaatccagactagtagaccacaaccgatgaccgaaccagtctctaacgagaattct
ccaacggcagaaacaaaagaaacagcgacccctccctccgactttctggctagaacttac
ggtcttgaaatggccaaaggatttgttacatcagcacctaaaccgtctgacttgctttat
gaacattctggagagggatctggggaactggatatggttgatttagtccacacttctgga
actactcaggcaagcaggcaaggaagcaccacatttgtttctgatagatccctggaaaaa
catcccgaggttccaagtgctaaagctgttactgttgatggattcccaacagtttcagtg
ttgctgcctcttcatgtagagcagaatgaaagctcccctgctccaactagcacactgtca
agcacaaggtcatatgagaggtccacagaaggtgctgcagatagcttccaagaccatgtc
aaagggtttgaggattccactgtcaagcctaacagaagaacaaccactgaaaacattatt
atagatctggacaaagaggacaaggatttaatactgacaattacagagagcaccatcctt
gaacatctccctgagttgacatcagataaaaatactatcatagatatcgatcacactaaa
cctatatatgtagacatccttgggatgcagacggacatagatccagaggtactagccgga
ccccatggcagcagtgaagaaagtgcccaagttcaagagaagtatgaggcagctgttaac
ctttctttaactgaagaaaacttcgagggctctggtgacactcttctggctaatgacact
cagacaacgcatagtgaatcgatgccttcggaagacagaagccgcttagaccatacgggc
tttatcttcacaaccaggatccctgttcccagcacagaaacagaattagatatttggctt
cccacagcgacctccctgcccatccctagtccatctgccacagttactccagagaccgag
gaaccaaaaagcgaagcaaaagccctggatgacaccttcgaatcaagtactttgtctgac
ggtcaagctattgcagaccaaagtgaagttatatcaacattgggccacttggagccacgg
gatgagtatgaagaaaagaaatacgtagctccttctttccagccagaattctcatcagga
gccgaggaggcactgatcgatcctacaccctacgtaagtattggtactatccaccatatg
gctcagagtttgacagaggcacctaacgtgatagaaggatccaatccctcggatgacact
gatacaacatcggcagcttcagcttttgccaagttgtccttccaaacaccatcatctccg
ctcaccggctacgtaggcagcggagcctctgagcaggcagagggcccccaggccggtgct
gtgcctggtacagatgctggcatggctcacgggtctccaggaaaacttgcagacactgaa
gtgactttcacatcatcgagcgaagagccctttcacataaccgagcctccatccttatct
cctgacactggattagagccttcagaagatgaaagtaatcctaaattattagaaccaaca
gaagcttctcccacaaagccgactgctgaagaaggaactgagattctccaaggttctcaa
acccaaaccaatattcaactgtctggagagacaatgaagaaccatgttagaacacccgag
gctggaactgtggtcacaactgcaggtgaaattaagttagaaggtgctacactgtggcca
cattctacttctgcttctgcagtttatggagttgaggcagatgtcatgcctcagcccagc
ccacagacttctgagaggcccaccgttccttcctctctggaaataaaccctgaaacacaa
gcagccttgatcggaggggaggattacacagtagcagcatctgaccagcaagtatcagcg
aggattcttgattccaataatcaggccacagtaagcattgcagagttacatactgagctc
gcaacaccgtcgttttcccttctggaaacttctaatgaaaccggtttcctgattggcatt
aatgaagagtcagtggaaggcacagcagtctatttaccaggacccgatcgttgtaaaacg
aacccgtgccttaatggaggcacctgttatcctactgaaacttcctacgtatgtacctgt
gtgccaggattcagtggcgaccagtgtgagcttgatttcgatgaatgtcactctaacccc
tgtcgcaatggagccacgtgtgtggatggttttaatacgttcaggtgcctctgccttccg
agctacgttggtgcactttgtgaacaagacacagagacgtgtgactacggctggcacaaa
ttccaaggccagtgctacaaatacttcgcccatcggcgcacgtgggacgcagctgaacgg
gaatgccgtctgcagggcgcgcatctcacaagcatcctgtctcacgaggaacagatgttt
gtgaaccgtgtggggcatgattatcagtggataggcctcaatgacaagatgtttgaacat
gacttccgttggaccgatggcagcacactgcaatatgagaactggaggcccaaccagcca
gacagcttcttttctgctggagaggactgtgttgtaatcatttggcatgagaatggccag
tggaatgatgttccctgcaattatcatctcacttatacctgcaagaaaggaacagttgct
tgcggccagccccctgttgtagaaaatgccaagacctttggaaagatgaaacctcgttat
gaaatcaactccctgattagatatcactgcaaagatggtttcattcaacgccaccttcca
actatccgttgcctaggaaatggaagatgggctatgcctaaaattacctgcatgaacccg
tctgcataccaaaggacttactctaagaaatactttaaaaattcttcatcagcaaaggac
aattcaataaatacatcaaaacatgatcaccgttggagccgaaggtggcaggagtccagg
cgctga

DBGET integrated database retrieval system