KEGG   Canis lupus familiaris (dog): 491845
Entry
491845            CDS       T01007                                 

Gene name
KDM6A
Definition
(RefSeq) lysine-specific demethylase 6A isoform 1
  KO
K11447  lysine-specific demethylase 6A [EC:1.14.11.68]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    491845 (KDM6A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    491845 (KDM6A)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.68  [histone H3]-trimethyl-L-lysine27 demethylase
     491845 (KDM6A)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    MLL3/MLL4 complex
     491845 (KDM6A)
   Histone demethylases
    491845 (KDM6A)
SSDB
Motif
Pfam: JmjC TPR_1 TPR_2 TPR_8 TPR_16 TPR_17 TPR_12 TPR_19 TPR_9 TPR_11 SNAP TPR_15 ANAPC3
Other DBs
NCBI-GeneID: 491845
NCBI-ProteinID: NP_001184114
Ensembl: ENSCAFG00000014589
UniProt: E1NZ77 E1NZ78 F1P8Q7
Position
X
AA seq 1419 aa
MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFV
RFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYY
SLQSDYWKNAAFLYGLGLVYFHYNAFHWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVN
TDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQ
VKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKV
QDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGT
LYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQAQLCNLPQGSLQNKTKLLPSIE
EAWSLPIPAELTSRQGAMNTAQQACKPHHPNTEPVLGLSQTPISQQSLPLHMIPSSQVDD
LSSPAKRKRTSSPTKNTSDNWSSGHAVSHPPVQQQAHSWCLTPQKLQMRQTGVAQVRSTG
IPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTS
RTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQG
LHKGQSSHLAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSH
TATSGGQQGITLTKESKPSGNTSMVPETSRHAGETPNSTASVEGLPNHVHQVTADAVCSP
SHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSA
ISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDVLLISHKPNPQII
PSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPS
IYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRT
QLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSD
SESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHV
GHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCE
KNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVG
PLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQ
CQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCA
RKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSSSS
NT seq 4260 nt   +upstreamnt  +downstreamnt
atgaaatcctgcggagtgtcgctcgctaccgccgccgctgccgccgccgctttcggtgat
gaggaaaagaaaatggcggcgggaaaagcgagcggcgagagcgaggaggcgtcccccagc
ctgacagccgaggagagggaggcgctcggcggactggacagccgcctattcgggttcgtg
aggtttcatgaagatggcgccaggacgaaggccctactgggcaaggctgttcgctgctac
gaatctctaatcttaaaagctgaaggaaaagtggagtctgatttcttttgtcaattaggt
cacttcaacctcttattggaagattatccaaaagcattatctgcataccagaggtactac
agtttacaatctgactactggaagaatgctgcctttttatatggtcttggtttggtctac
ttccattacaatgcatttcactgggcaattaaagcatttcaggaggtgctttatgttgat
cccagcttttgtcgagccaaggaaattcatttacgacttgggcttatgttcaaagtgaat
acagactatgagtctagtttaaagcattttcagttagctttggttgactgcaatccatgc
actttgtccaatgctgaaattcaatttcacattgcccacttatatgaaacccagaggaag
tatcattctgcaaaggaagcttatgaacaacttttgcagacggaaaacctttctgcacaa
gtaaaggcaactgtcttacaacagttaggttggatgcatcacactgtagatcttctggga
gataaagctaccaaggaaagctatgctattcagtatctccaaaagtccttggaagcagat
cctaattctggccagtcctggtatttccttggaaggtgctattcaagtattgggaaagtt
caggatgcctttatatcttacaggcagtctattgataaatcagaagcaagtgcagataca
tggtgttcaataggcgtgctatatcagcagcaaaatcagcctatggatgctttacaggct
tatatttgtgctgtacaattggaccatggccatgctgcagcctggatggacctaggcaca
ctctacgaatcctgcaaccagcctcaggatgccattaaatgctacttaaatgcaaccaga
agcaaaagttgtagtaatacctctgcacttgcagcacgaattaagtatttacaggctcag
ttgtgtaaccttccacaaggtagtctacagaataaaactaaattacttcctagtattgag
gaggcgtggagcctaccaatccccgcagagcttacctccaggcagggtgccatgaacaca
gcacagcaggcatgtaaacctcatcatccaaatactgaacctgtattaggcctcagtcaa
acaccaatttcacagcagtccttgccactacacatgattccttctagccaagtagatgac
ctgtccagtcctgccaagaggaaaagaacatctagtccaacaaagaatacttctgataat
tggagtagtggccatgcagtgtcacatcctccagtacagcaacaagctcattcgtggtgt
ttgacaccacagaaattacagatgagacaaacaggagttgcacaggtacgatctactgga
attcctaatgggccaacagctgactcatcactgcctacaaactcagtctctggccagcag
ccacagcttgctctgaccagagtgcctagcgtctctcagcctggagtccgccctgcctgc
cctgggcagcctttggccaacggacccttttctgcaggccatgttccctgtagcacatca
agaacgctggggagtacagacactatattgataggcaataatcacataacaggaagtgga
agtaatggaaacgtgccttacctgcagcgaaacgcactcactctacctcataaccgcaca
aacctgaccagcagcgcagaggagccgtggaaaaaccaactatctaactccactcagggg
cttcacaaaggtcagagttcacatttggcaggtcctaatggtgaacgacctctctcttcc
actgggccttcccagcatctccaggcagctggctctggtattcagaatcagaatggacat
cccaccctgcctagcaattcagtaacacagggggctgctctcaatcacctctcctctcac
actgctacctcaggtggacaacaaggcattaccttaaccaaagagagcaagccttcagga
aacacatcgatggtgcctgaaacaagcaggcacgctggagagacacctaacagcactgcc
agtgtcgagggacttcctaatcatgtccatcaggtgacggcagatgctgtttgcagtcct
agccatggagattctaagtcaccaggtttactaagttcagacaatcctcagctctctgcc
ttgttgatgggaaaagccaataacaatgtgggtactggaacctgtgacaaagtcaataac
atccacccagctgttcatacaaagactgataattctgttgcctcttcaccatcttcagcc
atttccacagcaacaccttctccaaaatccactgagcagacaaccacaaacagtgttacc
agccttaatagccctcacagtgggctacacacaattaatggagaaggaatggaggaatct
cagagccccatgaaaacagatgtgcttctgattagccacaaacctaatcctcagatcata
ccatcaatgtctgtatccatataccccagctcagcagaagttctgaaggcatgcaggaat
ctaggtaaaaatggcttatctaacagtagcattttattggataaatgtccgcctccaaga
ccaccatcttcaccataccctcccttgccaaaggacaagttgaatccacctacacctagt
atttatttggaaaataaacgtgatgctttctttcctccattacaccaattttgtacaaat
ccaaacaaccctgttacggtaatacgtggccttgctggagctcttaagttggacctggga
cttttctctaccaaaactttggtggaagctaacaatgaacatatggtggaagtgaggaca
cagttgttgcaaccagcagatgaaaactgggatcctactggaacaaagaaaatctggcat
tgtgaaagtaatcgatctcatactacaattgctaaatatgcacagtaccaggcctcctcc
ttccaggaatcattgagggaagaaaatgagaaaagaagtcaccataaagaccattcagat
agtgaatctacatcttcagataattctgggaggaggaggaaaggaccctttaaaaccata
aagtttgggaccaacattgacctgtctgatgacaaaaaatggaagttgcagctacatgag
ctgactaaacttcctgcttttgtgcgtgtcgtatcagcaggaaatcttctaagccacgtt
ggtcataccatactgggcatgaacacagttcaactgtacatgaaagttccaggaagcaga
acaccaggtcatcaagaaaataacaacttctgttcggttaatataaatattggtccaggt
gactgtgaatggtttgttgtccctgaaggttactggggtgttctgaatgacttctgtgaa
aaaaataatttgaatttcctaatgggttcttggtggcccaaccttgaagatctttatgaa
gcaaatgttccagtgtataggtttattcagcgacctggagatttggtctggataaatgca
ggcactgttcattgggttcaggctattggctggtgcaacaacattgcttggaatgttggt
ccacttacagcctgccagtataaattggcagtggaacggtacgaatggaacaaattgcaa
agtgtgaagtcaatagtacccatggttcatctttcctggaatatggcacgaaatatcaag
gtctcagatccaaagctttttgaaatgattaagtattgtcttctgagaactctgaagcaa
tgtcagacattgagggaagctctcattgctgcaggaaaagagattatatggcatgggcgg
acaaaagaagaaccagcgcattactgtagcatttgtgaggtggaggtttttgatctgctt
tttgtcacaaatgagagcaattctcgaaagacctacatagtgcattgccaagactgtgca
cgaaaaacaagtggaaacctggaaaattttgtggtgctagaacagtataaaatggaggac
ctgatgcaagtctatgaccaatttacattagctcctccattaccatcctcctcatcttga

DBGET integrated database retrieval system