KEGG   Capra hircus (goat): 102183106Help
Entry
102183106         CDS       T02910                                 

Gene name
PLK2
Definition
(RefSeq) polo like kinase 2
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
chx  Capra hircus (goat)
Pathway
chx04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102183106 (PLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102183106 (PLK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:chx03036]
    102183106 (PLK2)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     102183106 (PLK2)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   102183106 (PLK2)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102183106 (PLK2)
   Centrosome duplication proteins
    Regulators of centriole replication
     102183106 (PLK2)
  Sister chromatid separation proteins
   Polo kinases
    102183106 (PLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 102183106
NCBI-ProteinID: XP_017921214
UniProt: A0A452G4V7
Position
20
AA seq 685 aa AA seqDB search
MELLRTITYQPAASTKMCEQALGKACGGDSKKKRPQPSPEEPQPPQTPAQVQPAVPHHHH
HHSHSGAEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAK
PHQREKIDKEIELHRILHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEP
EVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTI
CGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMP
SSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPA
KNFFKKAAAALFGGKKDKARYIDTHNKVSKEDEEIYKLRHDLKKTSITQQPSKHRTDEEL
QPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLR
GCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPD
KKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDVRRPRL
YLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTL
LMSGCSLELKNRMEYALNMLLQRCN
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggagctcttacggactatcacctaccagcctgccgccagcaccaagatgtgcgagcag
gctctgggcaaggcttgcggcggggactcgaagaagaagcggccgcagccgtcccccgag
gagccgcagccgccgcagaccccggcgcaggtgcagccggcggtcccgcaccatcatcac
caccactcgcactcgggggccgagatttcgcggattatcgtcgaccccacgacggggaag
cgctactgccgcggcaaagtgctgggaaagggtggctttgcaaaatgctacgagatgaca
gatttgactaacaacaaagtctacgctgcaaaaattattcctcacagcagagtagccaaa
cctcatcaaagggaaaagattgacaaagaaatagagcttcacagaattctccatcacaag
cacgtcgtgcagttttaccactacttcgaggacaaagaaaacatttacattcttttggaa
tattgcagtagaaggtccatggctcatatcttgaaagcaaggaaggtgttgacagagcca
gaagtccgatattacctcaggcagatcgtgtctggactaaagtaccttcacgaacaagaa
atcttgcatagagatctcaaacttgggaacttttttatcaatgaagccatggaactaaaa
gttggggactttggtttggcagccaggctggaacccttggaacacaggagaaggacgata
tgtggtaccccaaattatctttctcctgaagtcctcaacaaacaaggacatggctgtgaa
tcagacatctgggccttaggctgtgtaatgtacacaatgttactaggaagacctccattt
gaaactacaaatctgaaagaaacttacagatgtataagagaagcaaggtatacaatgcct
tcttcattgctggctcctgctaagcacttaatagctagcatgttgtccaaaaatccagaa
gatcgtcccagtttggatgacatcattcgacatgatttctttttgcagggcttcactcca
gatagactctcttctagctgttgtcacacagttccagatttccacttgtcaagcccagct
aagaatttctttaagaaggcagctgctgctctttttggtggcaaaaaagacaaagcaaga
tatattgacacacataataaagtatctaaagaagatgaagaaatttacaagcttaggcat
gatttgaaaaagacttcgataactcagcaacccagcaaacacaggacagatgaggaactc
cagccacctaccactaccgttgccagatctggaacacccgcagtagaaaacaagcagcag
attggagatgctattcggatgatagtcagaggaactcttggcagctgcagcagtagcagt
gagtgccttgaggacagtaccatgggaagtgtcgcagacacggtggcaagagtccttcga
ggatgtctagaaaacatgccagaagctgactgcatccccaaagagcaactgagcacttcc
tttcagtgggtcacgaagtgggttgactactctaacaaatatggctttgggtaccagctc
tcagaccacactgtaggagtccttttcaacaacggtgctcacatgagcctccttcccgac
aaaaaaacagttcactattatgcggagcttggccaatgctctgttttcccagccacagat
gcccctgaacaattcattagtcaagtgacggtgctgaaatacttctctcattacatggag
gagaacctcatggatggtggagatctgcctagtgttactgatgttcgaagacctcgactc
tacctccttcagtggctaaaatctgataaggccttaatgatgctcttcaatgatggcacc
tttcaggtgaatttctaccacgatcatacaaaaataatcatctgtagccaaaatgaagaa
taccttctcacctacatcaatgaggacaggatatctacaacttttagactgacaactctg
ctgatgtctggctgttcattagaattaaaaaatcgaatggaatacgctctgaacatgctc
ttacagaggtgtaactaa

DBGET integrated database retrieval system