KEGG   Ciona intestinalis (yellow sea squirt): 100176083
Entry
100176083         CDS       T01056                                 
Name
(RefSeq) myosin light chain kinase, smooth muscle isoform X2
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
cin  Ciona intestinalis (yellow sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cin01001]
    100176083
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     100176083
Protein kinases [BR:cin01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100176083
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig Pkinase V-set C2-set_2 PK_Tyr_Ser-Thr fn3 Ig_6 Ig_C17orf99 Pur_ac_phosph_N Kinase-like APH
Other DBs
NCBI-GeneID: 100176083
NCBI-ProteinID: XP_002122169
Position
9:complement(91625..140820)
AA seq 2349 aa
MSTDRRPYFSQVLTHRDVTHGDRVRFECKVEGRPKPTVVWNKDGKVVTASSRVRVMEIYG
SHSLVISRTEHTDNGVYSITASNHVGSETCSAQLHVQDMSASRGSSTSQLSAYGRSSSTR
SSPSTSNLSSPSLSPKLARAATSRLVSGGNSPWSTGLKSSGSSGGAPPRRRGPGFILRPR
PQTIAIGERLCLKCTLLGHPKPTVTWEKDGELVDEDRTDGRIRTTNDGNDYFLQIDECGA
GDAGKYGVTARNSLGKQTAAVDVVVSGSGGHPTNNNNVTKSTPRLNKNNNDNNNVSRHDE
PAGGARVTNVRTNRAMELILPSHKREEDLKESPTSSISSTISSHSRISTSSSRSNASGHH
GDDTEVNRPIKSSWRRSNFVAPTFTRRLSSTQVLEGEELLLQCDVAGEPEPDLLWLRNGR
EVGIDEDEVFTSYRNGTARLRLRDVQVNHAGEYICKARNEAGAIQCSSRVTVKAKPVHIR
PRFTKSPGDARVTEGDTLILEAGVEGSPLPEILWSLDGEEVSHGETSFENNVAKLIIRKI
DTSHSGQYMCNALNTAGEDSVACRVRVKQKKRDIPPEFTAPLSDVKSKEGDDVCLRCMVT
GIPEPTVQWMYNDEVLEAEEGLEIIFHEGVAALTLEQATNEDTGVYTCVAVNGEGRATTT
CQVAVTAAPKVEKKSVPTSAPKFATTFDEYIRAQDGDKLVLECSVTGHPEPEVTWSLNDQ
SVPNTTASFKNGIAKLTIDPVSSTHSGHVKCSIQNTAGKANHEARVYVRSKRVAPTFEKE
LPESIVVNEGEEACFECQVRGHPQPRVTWSRDGRSLSVLSTETSYEDGKASVRIRKAGTR
EGGRYTCTARNLSGEAESVCIVTVATKMEEPKTSAPKFTKEMKDVELVDGQDLHLTCHVS
GLPTPDVHWEVDGQRLEAEDGDVSYKDGVAKLVLEDVMKEDTGRYECIAKNEVGNAKSGC
NVTVKAPTKEVEPVAPKAEVVPTKPTKPTKLEKEPSFPIQLDDHTVEEGDDIVLKCQVKG
IPRPKITWLLDGEEILDAELKYDDDGHAHLVLPEALPEDEGVYTCIAENPLKRVMCSCKV
TIAALAATSKRSMKPKPAEDVVVPRAVEVDSAPPSSGHTAPSFTKNLEDRLIQDGSTDVL
LSCVVTGNPPPTAKWFFEDEELEDSDDFKMIIDGNVRSLVIGEVFPEDSGVYMCVAGNTA
GEARSKCKITVEEIEGETPTFLMKPKQVNVNAGERALFSCRVDGDPPPSVEWLFCNQPIQ
ESDRALITKADPNNNYTHSLEIPQVSPQDAGRYAVCCRNLLGDVTCTVSLIVSDAKKQET
RKDFRDVLRKSPAVKTNQAGKPLTDEQVDFRGLLRRTSTDKDLGKRTTSTSGSEDAGDDA
GAVYKEALSVSVKTKALTEEERKRRKAEQLDFRGNLVRKVEPKVTSLDVLRTKSPEQQDF
REEALKTKVRTKALGQDDLKHMTPEQKDFRAEAIKSKVVTKAYKEELIKTKRAEQVDFRD
VLSPTKKAEMERKEAESLSISELPRGKWRKESGDHNMVATKRTRHKGAAAIVPVRKVQEN
GRESEEEEEKSENVESKPEFTRFMDDYEATDGQPFTLECTVVGEPRPEITWYLDEEEVKA
EADITITYEGDICRFSIAESFPDDQGKYSCTARNKYGESTCSAFVTVVGEQTTSPKPAYV
MKKKSPSVNVPASIKDGPQDMTILRGNPISLCCSLVGTSPLKVVWRKGRNEIKHSHQCSI
ETTGTLSALTISKSERGDSGCYTLQVSNTDGVDQFSVSVSVVDVPDPPGKPFPENASSNE
MIVSWYGSGFDGGSPITSYLLEMSKVNESGSSRKTWAEVSTTNSTSFTVKGLETNASYLY
RVSASNKYGTSRPGPVSDVLRNVSPTQENGAESSGDEEDFVEYGPVTIKKEKFSGKYEVK
EKLGQGRFGKVHRVVDRAMNREYAAKIMRALKARDREAVNMEIDIMNQLRHPRLVQLIDA
YTHGREMIMVMDLVAGGELFERVIDEDFELTEAACIKYMRQICDGVEFMKRSQIVHLDLK
PENIMCINKTGTQIKIIDFGLARKFNPNEVTRVMFGTPEFVAPEVINYDAIGFETDMWSV
GVICYILLSGLSPFCGDADSETLSNITAVQWDFDDESFDQISEDAKDFISKLLVKELKQR
FDVNQALQHRWLKRDTNKMSKSKLNKKNLRRFLARRKWQKTGNAVRALGRLASLARLAPS
SSSHSGQQRESGFLSSLKAQLIRENESQQERKKPCFLRTFDDIEVIEGSAAKFSCTVSGN
PDPDVMWLIDGEPIKESRHFRMAYTEDNQCTLLIMDTSGTDEAEYTCKASNSEGEVQHSA
ELIVITPGV
NT seq 7050 nt   +upstreamnt  +downstreamnt
atgtcaaccgatcgacgaccttacttctcacaagttctcacgcatcgtgacgtcacacat
ggagatcgagtgagattcgaatgtaaagttgaaggaaggcccaagccaactgtggtgtgg
aacaaggacggcaaagtagtcaccgcatcgagtagggtgcgtgttatggaaatatatggt
tcacatagtctcgtaatatcaagaactgaacacaccgataacggagtctactcaattact
gcttccaaccacgtgggatcagagacttgttccgcacaactacacgttcaagatatgtcg
gcttcacgcggatcatccaccagccagttatcagcctacggtcgcagtagttcaacacgt
agcagtccttctacttcgaatcttagttcgccctcactttcacccaaacttgcgagggcc
gccacctcccgtctcgtatctgggggcaactcaccctggtcgactgggctcaagtcttca
gggagctcagggggagccccaccgaggcggaggggtccagggtttattcttagaccaaga
ccccaaactatagcaatcggagaaagattgtgtttgaaatgtacgttacttggccaccca
aagcctaccgttacttgggagaaagatggagaacttgttgatgaagatcgaacggacggt
cgtattcgaacaaccaatgacggaaacgattattttcttcaaattgatgaatgtggggca
ggtgacgcagggaaatatggggtcactgcaaggaactcactgggaaagcaaactgctgct
gttgacgtcgttgtgtcaggtagcggaggacatcccaccaacaacaataacgtcacgaaa
tccactcctcgtttaaacaagaacaacaatgacaataacaatgtctcccgtcacgacgaa
ccagcagggggagctagagtgaccaacgtccgaacaaaccgagcgatggaattgattttg
ccaagtcataagagagaagaggatttaaaagaatcgccgacatcatcaatttcctcgaca
atttcgtcacattccagaatttcgacatcatcgtcgcgctccaatgcttctggtcaccat
ggagacgacactgaggtaaaccgaccaattaaatcaagttggcgacgttcaaactttgtt
gcaccaactttcacacgacgattgtcaagcacacaagtattggaaggtgaggagttgttg
ctccagtgcgatgtcgccggtgagcccgagcctgacctcttgtggttgcgcaacggacgt
gaggttggcatcgacgaggacgaagtatttacatcgtatcgcaacggcacggcaaggtta
cgacttcgtgatgtgcaagtcaaccatgcgggggaatatatttgtaaagcaaggaacgaa
gctggggcgattcaatgcagtagtagagtcacagttaaagcgaaaccagttcacattcgt
ccccgtttcaccaagtcaccgggtgacgctagagtgaccgagggtgacacgctcatcctc
gaagcgggggtcgagggaagtcccctccccgagatactttggtcactagatggcgaggaa
gtgtcgcacggggaaacttcgtttgagaataatgttgcaaagttgataatccgcaagatc
gacaccagccacagcggtcaatacatgtgtaatgccttaaacacagcaggggaggattca
gttgcatgtagagttcgtgttaaacagaaaaagcgggacatcccaccagagtttacagcg
ccacttagcgatgtgaaatccaaggaaggcgatgacgtttgtttgcgttgtatggtgact
gggattcctgaacctacagtacaatggatgtataacgatgaggtattagaggcagaagaa
ggcttggagatcatcttccatgaaggggtggcagctcttacattggaacaagccaccaat
gaagatacgggtgtatacacttgtgttgctgtcaatggggaggggagggcaactacaact
tgccaggtggccgtaacagctgcccctaaagttgagaagaagagcgtgcccactagcgcc
cccaaatttgcgacaacatttgacgaatatatccgcgcacaagatggcgacaaacttgtt
cttgaatgctccgtgaccggtcacccggaaccagaggtcacatggtctttaaacgaccaa
tcggtgcctaacaccacagcaagcttcaagaacgggattgccaagcttacaattgacccg
gtatcgtccacacatagtggccatgttaaatgctcgatacaaaacactgctggtaaagct
aaccatgaagcgagggtgtatgtcagatctaagcgagttgctccaaccttcgagaaggaa
ctcccggagtcgattgttgtgaacgagggtgaggaggcttgcttcgagtgtcaggttcga
ggtcacccacaacccagagttacctggagcagagacggtcggtcacttagtgtgttgagc
acggagacatcatatgaagatggaaaagcttcggttcgaattcgcaaagctggaacacgc
gagggcggtagatacacttgcacggctcgcaacttatcaggggaagcagagtccgtgtgt
atcgttaccgtggcaacgaagatggaagaaccgaagacctcagctccaaagtttacgaag
gaaatgaaagacgttgagttggttgatggacaagatttacaccttacatgccacgtgagc
ggcctccccacccccgatgttcattgggaggtagatggacaaaggttggaagctgaagat
ggagatgttagttataaagacggggtggctaagttggtgttggaagatgtgatgaaggaa
gacacaggaagatatgaatgtattgcaaagaatgaagtgggaaacgctaagtccggttgt
aatgttactgttaaagctcccaccaaagaagttgaacccgtcgcccccaaagcggaagtt
gtcccgaccaaaccaaccaaaccaacaaagttggagaaagagccatctttccccatccaa
ctggatgaccatacagtagaggaaggcgatgatatcgtgctcaagtgtcaagttaaagga
atacctaggcctaagatcacctggttattggatggggaggaaatattggatgctgagtta
aaatacgatgatgacggccacgcacacttggtattacctgaagccctccccgaagacgaa
ggggtgtacacatgtatcgccgagaatccacttaaacgggtcatgtgctcgtgtaaagtt
acaatcgcagcacttgctgcaacttcaaagagatctatgaaaccaaaacctgcagaagat
gttgttgtgccgcgtgcagttgaagttgactcagcacccccatctagtggccatactgca
ccaagtttcacgaagaatcttgaagatcgtttgatccaagatggaagcaccgatgttctg
ctatcctgtgttgtgactggcaacccccctcccacagccaagtggttttttgaagatgag
gaattagaggacagcgatgacttcaagatgatcattgatggtaatgtgaggtctctggtt
attggggaggtgtttccagaggattctggtgtttatatgtgtgtggctggcaacactgct
ggggaagcgaggagcaagtgcaagattactgtggaagagattgagggcgaaaccccaaca
tttttaatgaaaccaaagcaagttaacgtgaacgctggtgaacgagctctattctcgtgt
cgtgtggacggtgaccctcccccctccgtggaatggttgttttgcaaccaaccgatccag
gaatccgatcgagccttgatcacaaaagctgacccaaacaacaattacacacactcgcta
gaaataccacaagtctcgccacaagatgccggtagatacgccgtgtgctgcagaaacctc
cttggtgacgtcacatgcaccgtatctttgatcgtgagcgacgcaaagaaacaagaaacc
aggaaagatttccgtgacgtactcaggaaatcccccgcagtgaaaactaaccaagcgggg
aaacccctaactgacgaacaggtggattttcgtggattgttacgtagaacgtcaacggat
aaggatctcgggaaacgaacgacgtcgaccagcggatctgaggacgccggcgatgacgcg
ggagccgtctacaaagaagctctttcagtttcagtgaaaacaaaagccctgactgaggaa
gaacgcaagagaaggaaagcagaacaactcgatttccggggaaacctcgtgcgtaaagtt
gaacccaaagtgacaagccttgacgttctacgaacgaaatctcccgagcaacaagacttc
agagaggaagctttgaagacaaaagttcgaaccaaagctcttggtcaagatgacttgaaa
cacatgacaccagaacaaaaggatttcagagcagaagcgatcaaatcgaaagttgtcact
aaagcttataaagaagaacttataaagactaaacgcgcggaacaagttgatttccgtgac
gtgttgtccccaaccaagaaagctgagatggaaagaaaggaagctgaaagtttgtcgatc
tcggagttgcctcgtggtaaatggaggaaggaaagtggggatcacaatatggtggctacg
aagcgcacaagacacaaaggggccgctgctattgtaccggtgaggaaagtacaagagaat
ggaagagaaagcgaggaggaagaggagaagagtgagaatgttgaatcaaaaccagagttt
actcgtttcatggatgattatgaggcaaccgacggacagcccttcacgcttgaatgcact
gtggtcggtgaaccgagaccagagatcacgtggtatttggatgaagaagaagtgaaagct
gaagctgacatcactattacgtatgaaggcgacatctgccggttttcaatcgctgagagt
ttccccgacgaccagggcaaatattcatgcactgcccgcaacaaatacggcgagtccaca
tgttccgcgttcgttaccgtggtcggcgaacaaacgacgtctcctaaacctgcttatgtg
atgaagaaaaagagcccatcggttaacgtccccgccagtattaaagatggcccccaagac
atgacaatattaaggggcaaccctatcagcctatgctgttcattggtgggaacttctcca
ttgaaagtggtttggaggaaaggaaggaatgagataaaacacagtcaccaatgttccatt
gaaactactggtaccttgtcagctttaacaatcagtaaaagtgagaggggagattctggt
tgttataccttgcaagtatctaatactgatggagttgaccagttctctgtcagtgttagt
gtggttgacgtacctgaccctcccggcaaaccattccccgaaaacgcgtcgtcgaacgag
atgattgtatcctggtacggaagtggcttcgatgggggaagtcccattacttcgtacctg
ctggagatgtcgaaggtaaatgaaagtggttcttcccgcaaaacatgggcagaggttagc
accaccaacagcacctcattcacagtgaaaggattggaaactaatgcttcgtatctttat
cgcgtgagtgcttccaacaaatatgggacgagcagacccggtccagtgtccgatgttttg
aggaatgtttcaccaacgcaagaaaatggagccgagtcaagcggggatgaagaggatttt
gttgagtacggaccagtcaccataaaaaaggaaaagttttcgggaaaatatgaagtgaag
gagaagttgggacagggtagatttggcaaagttcaccgcgtggttgatcgggccatgaat
cgtgaatatgcagcaaagatcatgagggcgttgaaagctcgtgatcgtgaagctgtgaac
atggagattgatatcatgaaccaactacgccatccaaggcttgttcaactcatagatgct
tacacacatggaagggaaatgataatggttatggacttggttgctggtggagaattattt
gaacgagtgattgacgaagactttgaactaacggaagctgcttgtattaaatacatgcga
caaatatgcgatggggtggagttcatgaagagaagccagattgttcatttggatttgaaa
cctgagaacataatgtgcatcaacaagactggaacgcaaatcaagataattgactttggt
ttggcgaggaagtttaatcccaatgaagtcacaagggtaatgttcggaaccccagagttt
gttgctcctgaggttatcaactacgatgccatcggcttcgaaaccgatatgtggagtgtg
ggagttatctgttatattctactgtcagggttgtcaccgttttgtggcgacgcagattcc
gaaacattgtcaaacataacagctgttcagtgggattttgatgacgaatcatttgatcaa
atatcagaagacgcaaaagatttcatctcaaaacttcttgttaaagaactaaaacaaagg
tttgatgtaaaccaagcattgcaacatcggtggttgaaacgagataccaacaagatgagc
aaaagtaaattgaataaaaagaacctgagaagattccttgcaaggcggaagtggcagaaa
actggcaacgcggttcgtgccttgggtcggttggcatcgcttgcacgactcgccccgtcg
tcatcctcacatagcggacagcaacgagagtccgggtttctgtcatcgttgaaggctcaa
cttatcagggagaacgagtcacaacaggaacgcaagaaaccctgcttcctccgaaccttt
gatgacatcgaggttattgaaggttcggctgccaagttctcatgcacggtgtccggcaac
cccgaccccgatgtgatgtggcttattgatggggaacctatcaaggaatcgaggcatttc
aggatggcatacacagaggacaaccaatgtactttacttataatggataccagtggtaca
gatgaagctgaatatacatgcaaagcttcaaacagcgagggtgaagtccaacacagcgct
gaactaatcgtcataacaccaggtgtgtga

DBGET integrated database retrieval system