KEGG   Ciona intestinalis (yellow sea squirt): 100177029
Entry
100177029         CDS       T01056                                 
Name
(RefSeq) FERM, ARHGEF and pleckstrin domain-containing protein 1
  KO
K06082  FERM, RhoGEF and pleckstrin domain protein 2
Organism
cin  Ciona intestinalis (yellow sea squirt)
SSDB
Motif
Pfam: RhoGEF PH FERM_C FERM_N FERM_M FA PH_13 IQ_SEC7_PH PH_20
Other DBs
NCBI-GeneID: 100177029
NCBI-ProteinID: XP_009859507
Position
8:complement(5383636..5404916)
AA seq 1045 aa
MPHSSATVQVQMLDHSVHTYDVKVKSYGNMLLQSVMKDINLLESDYFGIQYTDRQGNRVF
LDPLKKIKSQITNISNVVLHFVVKFFPPDPGQLQEEYTRYLFALQVKQDIVDGLLPCNEN
TLVVMASYIAQSEFGDWNSFDCSDLSYLRDLKLLPPLVDMNEHDLLVKVSENHKIRTGET
KADSDYHLLDIVRRLEQYGLRLLPAKDQENTDIKLAVAHMGVVVFRGNSKINTFNWARIR
KLSFKKKRFLIKLRTETSVDKNGQNVGDILVFVMASRDTCKNFWRHCIEYHAFFRLEIHP
DPAPKPKIIKRGSTFRYSGKTQKQLHELVRNSNFRRTTFVRASARKPTIQPNNRTPQFNS
PAITVTPSVISTEHDDSGIPSPIKTEAEVNGHVTTTPDLTMASKGDGLVYSQKEEKPEEL
SPSSMATAAWQVESEHLHSSVVSVPSHETPDEAPDTTAQTAESQNESKSAEQVAPLPSPV
NLHSGGMSDPNDLTEVSALSVNGSVASSVVSPPGLLSTRGLKSTSSLSSETRYPSSQAYY
IAKEILTTERTYVKDLEVITTWFKSALQKEGSESLLPENTANQLFGGIGSLVALHQQFLC
TLDDRLSSWEGRGSTGATNDQLVDDLMLSHMLVLKKYLASLENGESLITAIEEVGDAEPK
FESLYREFELQKVCYLPFNSFLLKPMQRIAHYKLITERLMNYYEAESTLQQHPDLQSAYK
EACVLCTATQERLKRAHNLQKMAQLRRDLIGVEHLLKPNRTFIREGSLYKLSRKGFQQRL
FFLFSDCLVYTSKGVTSTNQFKVHAELPLQGMIIEVNEGESAVPNCFSILSASKTVIVAA
ATQEEMDKWLEDFSVAIARAGREMEMYESPLNNAAGSLSRLSMEQSSEDGEGSVRNSMER
LKPPMQHRSNATMHVCWHRNTSVSSSDHLVSLKNQLSGYLLRKFKNSNGWQKLWVVFTNF
CLFFYKSNQDESPLASLPLLGYTINSPTEADGIRKDFVFKLKFKTHVYFFRAESQYTYNR
WIEVISSATVTSQRTRLFSRMDSYQ
NT seq 3138 nt   +upstreamnt  +downstreamnt
atgccgcattcatcggcaacagttcaagtccagatgttggaccattctgttcacacatat
gatgttaaagttaaaagctacggtaacatgctcctacagtcagtaatgaaggatatcaat
ttactggaatccgattactttggcatccaatacacagacaggcaaggaaacagagtcttt
ttggatccacttaagaaaatcaaaagccaaattacaaacatcagcaatgtggttctacac
ttcgtggtcaagtttttcccaccagaccccggtcaactacaagaggaatatacccgctac
ttgtttgctttacaagttaagcaggatattgttgatggcctgctaccttgtaatgagaac
acattggtggtcatggcttcatacatagcccaatctgagttcggagattggaattcattc
gattgttccgacttatcctacttacgagatcttaagctcttacccccactagtggacatg
aacgagcatgatttgctcgtcaaagtttccgaaaatcataaaattcgaactggtgaaacg
aaagcagactccgactaccaccttctagacattgttcgtcgccttgaacaatatggacta
aggctgctaccggcgaaagaccaggaaaacaccgacattaagcttgcagtggcgcatatg
ggggtcgtggtgtttaggggcaattccaaaatcaacacgtttaactgggcgcgaatccga
aaacttagctttaagaaaaaacgattcctgatcaaactaagaactgaaaccagcgttgac
aaaaatggtcaaaatgttggagatatcctagttttcgttatggcttcacgagacacttgt
aaaaacttctggcgtcactgtatcgagtatcatgcattcttccgactcgaaattcaccca
gacccagccccaaaaccaaagataatcaagagaggatctacgtttagatatagcggcaaa
actcagaaacagcttcatgagttagtacgcaacagcaacttccgtcgtacaacgtttgtt
cgagcttcagcgaggaaaccaaccatccaaccaaataaccgaacaccacagtttaactct
ccagctataactgttacgccgtcagtaatctccacggaacatgacgactctggtatacca
agtccaatcaaaacagaagctgaggtcaatggtcatgttacaaccacaccagacttaacc
atggcttctaaaggagatggtttggtttattcacaaaaggaagaaaaaccagaggagttg
tcgccttcaagcatggcaactgctgcgtggcaagttgaaagtgaacacctccacagcagc
gtagtatcggtgccaagccatgagacgcctgacgaggcaccagacaccactgctcaaact
gctgagtcacagaatgagtcaaaatctgctgagcaagtggcacctcttccatcccctgtt
aatctacattcaggtggcatgtccgaccccaatgatctcactgaagtttccgcactttcg
gttaacggatccgttgcatcgagcgttgtttcacctcctggacttctctccactagaggg
ctgaagtccacgtcatcgctgagcagtgaaacgcgctacccgtcatcacaagcttactac
attgcaaaggaaatacttacaactgaacgaacatatgttaaagatttagaagttatcaca
acatggttcaagtcagcactacagaaagaaggttctgaatctcttcttcccgaaaacacg
gcgaaccagctctttggaggaatcggatcacttgtggctcttcaccagcagttcctctgt
accttggatgatcgattatcgtcctgggaggggagaggatcaacaggagccaccaacgat
caactcgtcgatgatctgatgttgagccacatgcttgtgttgaagaaatatcttgcttcg
cttgagaatggtgaatcgctcatcacagcaattgaagaagttggagacgcagaaccaaag
tttgaatctctgtaccgggagtttgaactacagaaagtttgctacctgccgttcaactct
ttcctactcaaacctatgcagagaatcgcacactacaagttgattactgagcgcttaatg
aactactatgaggctgaatcaacattacagcaacatcctgatctacaatcagcttacaag
gaagcatgtgtgctctgtactgccacccaggagcgtctcaagcgagctcacaacctccag
aagatggcgcagttgagacgtgacttgattggcgtggaacatttgttgaaacctaaccgg
acttttattagagagggaagtttatacaaattatcgcggaaaggattccaacaaagactc
ttcttcctcttctctgactgccttgtatatacaagcaaaggggtcacttctaccaaccaa
ttcaaggtccatgctgaacttcctttgcaaggaatgatcattgaggtaaatgaaggcgag
agcgcggttccgaattgtttcagtattctctccgcttccaagacggtcatcgttgccgca
gcaacgcaggaagagatggataaatggctggaggacttcagtgtcgccattgcacgagct
gggagagaaatggaaatgtatgagtcgccccttaacaatgctgcaggatctctgagtcgc
ctctccatggagcaatcctcggaagatggcgagggctcggttcgtaactcgatggaaaga
ttgaaacccccgatgcagcatcgatccaacgccactatgcatgtctgttggcatcgcaac
acaagtgtcagctcgtcggatcacctggtctcgctaaagaatcaactaagtggatatttg
ttgagaaaattcaagaattcaaacggttggcaaaagttgtgggttgttttcaccaatttc
tgtctattcttctacaagtcaaaccaggatgaatcaccactagcaagccttccactgctc
ggttacaccatcaattcaccaactgaagccgatggaatacggaaagatttcgttttcaaa
ctcaagtttaaaacccacgtgtatttcttcagggctgaaagtcaatatacttacaacaga
tggattgaagtgattagcagtgccactgtgacgtcacagagaacccgtctcttcagtcgc
atggatagctaccaatag

DBGET integrated database retrieval system