KEGG   Ciona intestinalis (sea squirt): 100178935Help
Entry
100178935         CDS       T01056                                 

Gene name
con
Definition
(RefSeq) uncharacterized protein LOC100178935
  KO
K12567  titin [EC:2.7.11.1]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cin01001]
    100178935 (con)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cin04131]
    100178935 (con)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cin04812]
    100178935 (con)
   04147 Exosome [BR:cin04147]
    100178935 (con)
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100178935 (con)
Protein kinases [BR:cin01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100178935 (con)
Membrane trafficking [BR:cin04131]
 Others
  Actin-binding proteins
   Others
    100178935 (con)
Cytoskeleton proteins [BR:cin04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100178935 (con)
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100178935 (con)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 ig Ig_2 Pur_ac_phosph_N V-set fn3_2 Pkinase C2-set_2 Receptor_2B4 Pkinase_Tyr Tissue_fac THB Reeler Kdo
Motif
Other DBs
NCBI-GeneID: 100178935
NCBI-ProteinID: NP_001265922
UniProt: I7HGJ1
Position
9
AA seq 26404 aa AA seqDB search
MSNAEQTMSVSPQFIQPLQGIIAVEGGSATFEAIVAGSPRPEVRWFHGGEDVTGSLNYEI
SYSMDGRASLHINEVFDEDAGHFTCQVSNDYGKASSMAELVVETTTVPPDFTERLSNVEA
NQRETVRFVVQATGVPTPRVKWYREGAEIRNSNDFQIRCEGDLFSLTIAEVYEEDTGRFT
VTAANQGGKATSTAVLTVTGDGSIKSGRTDEDSERRMMMMTHGEDVSAHQTYQHNMQRSA
FVKGERTFSNSPDKKSTRTETQHSSMQSASSKMTGKSILKQRHQSPSPIRSVRMSPPVLR
TTTTTTHREQSSSPMSRVHSVKAPSPSRKQDKESTHEVQAPWKSGPPALNVHDSAKSEEL
SQPGTLREVMTSDVTMESEQHIQESKSRQSTEYYMEELQETSYTATAVRESASVHQQSVT
SVRQDNLSMTSSLRHENVATSLISSSTSSLSSSDKPPAAKRPYVAPVQQVGSLPSSVSHC
GEVKPIAGVHKVTPPSPMVHRTSSQQTIYRDLAAFPPFIKSGMKDVHVQEGDMTKLECEI
MGNPVPDVMWYREGAEIKSSHDFEITYDGQITRLLIRETFVDDAGHFTCTASSVAGSTSC
TCVLNVTQPQTKPERAPSASETELSMTDFDGFESTEAELDFVSGVSEAELTDTEIFKPSA
AAAKLVSNAINAGEPAPGATMLSPVVEEMSTHSGKASSKSMQSEGARVPNDVYPSGEPPQ
FLSTPASMVKLVEGASVKLECVISGVPEPRVTWAKNGQMLQSGHRFKIIQDRTKNLYCLV
IGMVFAEDIGEYTISATNQFGFISGSVMLISEDQYARFEEQDAIDRQSVEDQQRGVMAPP
SQLPPRGRGESRGRGVRRVIVSPARSPGLRKTSASPVKRLRETSRSPVRTMSPSKRLEEI
EQLDMKKYFRPKFLRKPESRECNEGEATRIDCKVTGRPLPDVTFYKEGSQVYEDYNHRIV
VKEDGIRSLIISPARPEDSGEYTVVARSAAGKAVSTLSLTVIPQEGIERPRILEKPQSVT
VKEGDMVRLEVFAVGRPTPEIVWLKDNVLLIPEKHPELRIEGVDGHGLLTIDRAAKGLHD
AWYTATAVNKAGRDLSRCKVNVNRIEYDPEPSRKLYIPKSKGLKQAVEPSPERVDLRKLD
NFDETDLYDSSRMQKPRIKKKLVSAKQKILGSVHFECHIVPIGDPTMRVEWLLDGKQLEY
ANRIMTTFEFGYAALDINAVYPRDTGVISCRATNAHGQVQSSCTLIVKEERGLVEKTQLP
DTTQLGKIETTERHRQEISLAHVSHQTDEVEVRSAPKIVLNPDPVVVQEGEPARFRCRVV
GSPLPKVDWYLNGQAIRQSKRFRIWSDGIHYFEIATVRGYDHGQVKMVAQNIEGSVEATT
TIEVSQARDLRTVLHKADIQTSDSKTKSRIDTNTLKSYRITRNVEEQFKEEKGRHMVPLR
EVEKPIAGLKKVKRVERHEELQSKFSKLSEEERMLNTFEADKKKSTQRDRKYESFIRKTK
DSLSHWDEPKPEEAPKIPFLQRPKQSLPPPYEIKVDVTPDMQAPVVLERIHNVTVQSGKD
ARFRVRFHGNPEPEISWYRNEIALEKSERLGWIFPENNVCELFIRDCHVDDSGSISVRIS
NPAGQAGSQGFLLVQEAVEALHFTESLTDVEAKENEKSVIFECSVSDFTAEVEWRRCGTD
GAAEEVLRTSEKFQTRADGAQRLLRIADIKLSDAGSYSCVMFAAGDKEIKSTAQLHVKVV
PKKIQSGLKNQVAREGGACDFTAVVSHAGVAGTWMKDGVEIQASSKHVITENGNKRSLTV
NDSRAADEGVYEYIYCDEKSLANLTVQAMHVSIVKKLKDMSVFAGEVVTLEVKISRDDAI
ATWSRNEQTVTSDKRLITTSDRSRHMLIIENCTVEDSGVYTFAAGTASCSATLEVKSVDV
TTGIQDSTNVESTDGVFECHVNQAGYSAGKWFCGQTEIKSDNAKYSVKTDGKKQVLVVHN
TTAQDSGVYSYVTGSKSTSEAKLVVIPVEITGTLQDVTEAETAAVNLTATLSESGVHGAW
FKDGQPLQNTSNVSAVVDGKQHSLFIRSLSLNDQGVYEFRIGNKTTSASLTVQGAQITKP
LSDATATETESVRFECQVASDGVQGSWMKNGELLDADYSHRFVSSSEGRTQILMINDVTK
EDSGSYSFKFGSASTSANLSITGIKFSKGLRNITVAEGSDADFTVEVANENISNVRWERN
GVMINCDDVKYRVQSQGQRFTLIVHCVTKKDEAAYSCIAGSAKTSARLYVEAVTITRKLT
EVRAMEHRNVELTTEVTNSSVSGVWTRNGVTVTETERVKTTHRGKTHQLVITDAQADDSG
SYQFAVGKSTTSAKVIVEAIHLTSRMKDVVVKETQTATYECEVSHPDVPAAACKWTKNGV
VIKPSNLISITVDGRTHRLKIHTCAAEDSGEYSFTAGEDSCTAALNVEAVTIVKQMPKKL
QANAHDVAVLECTVDAPGISAFWVKDGKRIDTTQDKSVKYEAISRDVTHTLKVKDIAAED
AGVYEFVAGSVRNKTTLYVEVVAVEITKSLKNIEVVENKKATLEFQVNKPNVKAQWFKNG
VQIDFMLMKRFKYTSADLTHKLSIDEVEFNDAGEYTFEAGNQKATAYLYVQPPEAPKFVQ
ELRNCIVIAGETAKFTVRATGRPAPEVKWYKEGITITPSFKHKILKDEDQYTLAVVEVEP
SDAGQYTCEATNENGTFRTTATLQVDSKVVMPVPSTPTVSPPAIVEPMQDFITREGQSAR
FQCKIIGTNPKVTWSRDGKRIKPSRYFKMSEYNGVYQLEVTEAYPEDEGTYSITASNDHG
DVSCSATLKLDRLFKSPVQEVEEQAAQEDVQTDSQPRKSRFPTIVSGQSNFQQLQQTDVF
MQQPSMMMKRPTEVSVRGKRTKPAFKRPLRDITVEFGCPARFVAVVTGHPTPLITWQHCG
NIIQDSHRYRYLMEGNKHNLVLPSVDHEDDGVITCTATNQSGQTTSTARLTVGQNLNISE
PDSYDAPFEMSSSSNVTIVNSIECSRTDEMYHSVDGASDLDSATYNATATDMQWTSMSES
YATTMEMYETEDSQTTASASEMTTLSISELDSTFSNQTVVSQKTHTQASKPTRKSKKVRI
KKAKHTSTGQGNVLDKSIAADWTEEVRKLIREEIDEREKMHQVVRPEPEMVNDKELEKSL
APRFVKNISDCEVGVGETAHFVYILQAEPPADILWMRNGSPISLDKNKVGDGVNSATDGN
IGIINDEGAGCLVISESEPHHSGIYACVASNEHGSTKCTATLLVTGHLAHVDRVEEITIE
QQLVHRESQTHESRMDPDEDRKIRDAFMELEKAERMRTVADVVIDESKKDEAVGKPEKQK
VEKPKRKKTRRKAEKEFSRFGDNETGEEEKLQPPTFEEELKVCKVRPGETVKLSCTVSGS
SPIEITWKRDGKVIEASSRCKVNTNESNPSLEIPDVSFSDAGNYSVTAVNQSGSASSTAS
VIVEGVSPAFIEKPEGGTCQLGDTFEFCAVVSGIPEPDIYWKHNGAPVRDDNQRTITSET
GGQYLLEVKDLALVDAGKYECVAENEAGQASSTVTLVVEEATLVDTLRSMESKKDVAQTS
ANIKFVEEPKSQDAATGDTVTFTAIVEGNPEPVVKWNKGKWRQIKNYGRVKIAHDKETNK
HTLTMSTLDKPDTGMYRCIASNASGEVSVQFDLRVTEQLVSEKMDKAELKKPAQKEEQKI
DVATISDLLKEVDPKEYEKYARHYGITDYRQLLSRYEELRSKEPKDVEAEAEEVGALYRL
MERSLSIDQPVEVVSDLQDVAVRKGRDARFTTELNIKVPGIEINWYKGNDRIYESSKYSI
LHEGTMFTLVVKNVSDKDIGEFRIVAGPHKSKAALTLTKEVYFTKHLENQRVRENCSAEF
DCAVNLADGVVTWYKNDVKLRASRKYEISSEPSTVEGETAHKLIITEMKPDDESTISAKV
TLTGHGTDTTAAKLEFSPEAFVKPLENRVVKEGETVTLECELFNANDEVVWLKEDKRIYP
GSKFALTRENSMHRLTINEPMQLDSAVYSCALKRDLSRRCSSSVAIDTSIYFKRILKQLM
LAREKVTAEESESLTLVCNVSRERARVLWLRDGVPLKPGPRYKTSISGFDRRLIINDVTK
EVDDGAKFACRIRDNDELTESVAEICVPSISDDILKPLKDQTVVEGKKATFECLISRDDG
KAVWYAGDKQISAQDKKYKTLAMKNLRRLIVVDCTLDDKMTYTCAVGDLKSSATLDVTPA
TRQEEARVLQKKIKHIEVEPEPEQEAVELKPIAGLKFVKTLENQSATMNTSITLVCELSH
PGVAVVWYKNKEQVYESNKYTITVDDTKHTLKIVGLSQDDKATFKCKAVPNPDVITTCKV
DVKEQEQTQDRIRFIEELEAINCTVKDTVVLECELSDPKAKVTWMKGNKPLEIDNDRFQA
LSDGARRSLVLRDVTLADSSAYTCKVADVFSTAEIFVEEQPTFLKEMTDQYFEEQAVGIL
ECEISRADATVRWLFNGEEIDITEHGKHTSEASGRKRTLVIDDLSKSDEGVYVCKTDGDA
ETQAHVSVEVKDVKLLKGLRDVSVLEGESATFETEISDERVKSQWLLDGKEIESSDNVSI
ISQGRRRSLIIKETNASHRGQVTFTAGRLKTNVHLAVQDQPIHFTEPLTDQIAEERGQAK
FVCRISRLDANVKWIRDRRTPIQESNKYEIKSDGTSRILIVHDVGYEDEVTFTCDTEDSK
STAKLTVTARLVEFVEPLQDQTVEEGKDATFSCVLNHDDVQVTWYKRGVKLLKGRDVIIE
SDGATHRITFNTVSVDDVGSISISAEGTQGAAELKVSTTEVEIVQQLKDETITEGESVTL
TCLLNKPNVIGSWFRNGVKLARTDLIVIRAEAEKHTLVVKNLTVDDAAEFTFTCDGCQSA
ANVSVTERPIMFTKKLQPLTCTEMDVAELSCEVSRVHGEVTWWKGDEQVVATERVELITE
SCWRRLVILKAEYNDEADYTCKCEADVTTAALTIGGRNIKIRRDLRDVEATEGQGVTFEC
EISHDDVNARWYLNGEIIKECDGVKIETVGRKHRLIIEKVTTERAGTIKFVASKASTEAE
LTVMEPLVEFVTPIHDLDVEEKAKAVFECEVSRPNAEVRWYKGRAIIRDSEKYEIRSDGC
KRTLVVLQCTFDDEKKYTCDADDARTSAKLTVQARAIKFLKPLEPNMRIVEREEVTFEIE
LSHTDVDVIWYKNGAKMARTKNIEIYTEGAIHRMVIHHANMEDYGVEVEAHAEEETSMTT
LYIDEITVKIEEPLKDLTIIEKETAVMTTVTNYDAVPHVWYKDDIKLVKSDTVEMTDEGK
LHTLKLVACKLEDTSEIKFVSKTAETKAHLTVIEPPVKFPQELKDKTCEEMDRVVLECNV
SRANAQVVWRKNDQEVEASEKYLIESDGIIRRLVLVDAAMSDNAQWTCDGKDSKTTSNLV
VKEIEIKFLKDLKATTVTESEDTKFECEINTSKAVQVQWLHFGKPIVDSKKLITKRTGGK
LQLEIKHTTVRDDGHYACLVRGVKTDARLTVKEQKNKIAVQMQNVKGVEEQPSVTFSCLL
EKETGNVKWLKDNKPIDISSAKYEAVCAGKQRSLLVKDLKKSDKGKYTCVCGDSKTTAEL
TVKDGVKFLKKLTDTTVLEKDGAILTCEVSDPEVKVRWYRDGLPVIDSDRISVKAEGKTH
TVSIPWTCLGDTGSYQAVAEFAKCNAKLTVEDAPLVFLEQLADASVEHLESATFTCKVSP
RDQKVEWYLGEKLLEGSERFVFSEDNKVRTLTIHQCTEHDRNNVSCTFADQKTVAVLKVG
DPPAWFEKELVALVCIEREVISMQCELSRPNVDVEWLRNGTVLGQSNRMQFIAEGIVRKI
EIADVLMEECGDYTVRVKDTDTTTTAHLTVNEIAPGILTEPVDVYCCVGDDITFSCGITK
TRYNVVWSLNDTEINDDMIKENKNRFALSKSDGGLTHTLTVNKAMLTDCGEVKAICEGIA
STRTATLTVVPIVFDVPPSDAVICATQTATFVGTTNKEGVKVTWSRNGKILEAGPQVAMR
AEGFNYYLEIKDCTLRDDHSLITAQVAECVVTSRLLVGEQPAKFASDKMDDTTVEEGDRA
CLSVDLTQQGGRVQWMVEGKPIIPDSRMQLVATGVSRTLVILDCKRGLDEKTYTCRCNGK
EISAKLIVTEAPLRFVQRLWDHDFEPSKTCLLECKLNKPFTNVVWTVDANVIKTDRRHTI
KVADDGKKHSLYITEFSEDDRGRYTATCTGTNVETTAIIDVAIAPVLEITNDQITMNADA
LSEVTAKFKAMPKPTISWLKEKDDTLVSVAEDSIVVNQDDTKLRFRKPKLSNSGRYKVVA
KNKYGEDSAYVTVTVIDCPQPPANLTVTDVTATSATLTWEEPEEDGGSPIMKFLVEKRDV
KRKMWQTVSDGVEDTEITVQKLVEGNTYLFRVSCENQVGLSKPTEISNPVLAKSQFELPQ
APQSVTLSEVRRDHAIISWKAPSFDGGSPITLYVVELRDKLHTTWTRCGVVENDCLQCAV
TEPEITPGKEYVFRVFAENAAGSGKPSSPTPLTRLEDPIEAPMQPRNLRYDNVTKSSLEL
CWDCPENDGGSPVTGYIIEVCDKAEGVWSAEGVIETVTGLHFVVCGLEESHEYSFRIRAT
NKVGEGKPSDPSPFVLAKDETKIPACDITQDKKDIVVVEPEPIRVSVPISGLPAPSITWV
RVCDGQVLCHSEDRVSLESGATYANMAVLPSNRQQDNGQYRLVLQNDQGTVECDFNVTVY
SKPGPIRNLSVAEVTSTSCYLSWETPEDDGGSEITTYVVERNEEKRKAWTKMKGSSEASE
CSVSDMKKGKIYRYRVCAENRHGKGPYTELSEPVVAEDPPRVPDAPRNLGYSNVKKDSIQ
LNWSMPVFDGGAAITGYIIEKRPEGDEEARFVADNQIPHRELKYTIRNLPTDTLWCFRVK
AVNRLGPGDCCEPTEPILIQSDEAAPTVQLDATVTDGVSVKAGSMIEIPAIVAGRPFPTA
RWSRNEVILLPDQRVTVDLVDNVSTLRVLMAKREDSGDYTVLAQNQHGKASINCSVQVMD
KPGKPASVDIEDITKNSCSVVWTPPTDDGGTGIIRYTVEKRETTRHVWTKLCGTVKADER
RFEVTKLIEGRTYEFQVTAENQIGFGEPQCSTSVVAKYPFGPPVAPDAPECRSVTRDGMT
VTWTQPPVRDAGAVTGYYLEMCVKGSQNWMKLQKKPLDADTLSYRVTGLTKDKTYVFRVS
AENLAGCGPASVPSDGTLARDPTKPPSKPGKPNVMEITKSTCRLRWRKPETDGGEPISNY
IIQLKKREVGVETWDEDFVPWELDVPDVEHVVVDLVPNTYEYAFRIVAANSAGNSEPGEE
SETVICKPILKTPSAPRDLKSAGTTKNSITLQWVRPDDDGGSRIKGYILEKRELRRQTWQ
PLEKELENETYVIEDLKEGGSYEFRVAAFNEIGTSGWTQSEPIAAVSMFSVPEQPRSLKI
DELFRYHVVLSWKEPVFDGGAPVVSYSVEKREKLSQRWVNVGKTEKADCTFKVRDVKEGT
ECQFRVMAENEAGLGKPSEPTEIITIQDPKSPPSEPLDLKLVTTSPTSITLAWTLPALNG
GLDVTGYFIERCLEGGEDWVRCNAAPFKTTQGEVTGLREERSYIFRAFALNEAGVSEPSK
PTDSIVAKEPDAAPTMKMLQNDIVLVAGEKLRVRVPITGSPKPSITWTRDDKAMKEYVKV
SLDDNCSVLFIPAAVREDGGRYTLTLENKIETITGWCHVTVLDRPGIPIDFAATEITKST
CQLTWKEPQDDGGSEILFYSVDRREAGRRTWTPVVAEVRKTTWQVTELLHRNEYNFRVTA
HNKVGAGKPVELASDIMAVDPLSAPSAPEELTYSEPRAKSVILSWKRPTNDGGCTITGYI
VEMKASDEERWNVVIRDHDSTSVTVLGQIEGKEYAYRVAGVNRIGIGQRSETPDLIMAKD
PLAVPTIEVSQILRKGLETRAGKEMRIEATYTGVPRPMISWVQQDKVDTPVEEDKARSTS
MIAFDGTTKYRVPDAKRSDKGTYLITAENDQGKATASVVVNVLDVPSPCKGPWSFEDGTN
EAVTLRWKVPEDDGGSDIINYVMEMKESNKKVWTNLSTTLQSTKYRATKLVENKEYIFRV
CAENKMGRSPWLEAAPYVAKLPFDPPAAPEKPLVVDVTRKSMTVKWVEPYDGGSTILGYC
LEKKDTSASRWSRASRELIRAVEFVVSTGLTEGLTYQFRVSAENEAGPSKFSQPSDYNVC
EDPVFAPSAPRKPRVVDTTSSSITLTWDRPEGDGGDAKLKYIVEQRLADGSWSRCNDKDL
DSTTFTVENLQDGQLYSFRIKSINRGGESSPATLPEVAARDMIDLPHIELDDSVVAGITV
VSGKKFVIPAKVTGRPYPEITWTKNGEDVTDRVDVKKTEDGSQVTVKRSIRSDWGEYKIS
AKNSSGAKSATCLVVVQDAPGAIKELKHGAVSRNCITLKWHAPEDNGGLPVKKYHLEKRD
MSMRAWLSVGSTDKFSMDVTNVLEGATYSFRICAENDLGKGPLTESIPVLCAEPLVVPGR
PENLRIEEKKDTSIALHWVTPRFDGGSKIKGYIIERKAEGEEEYIGCNTGLIEETKFVVK
ELETGKKYVLRVKAINNIGESQPALTQLTEAKEPEAEPEISLDVGIKGSMQVRAGASIHL
PATVLGVPAPEIVWTKGEDEKLVDGDHMKIINQNKTSSMYIEKSVRSDDGVYMVTATNSL
GSKTARVTVLVQDVPAAPLNFKPTKVTAESLLLTWEATPDNGGADLMNYVIEKREGKNKN
WTQMSTTVIDTKFRVAKLTEGTQYQFRVAGENKFGVGHYAESEPVIAKNPYDLPGPPYKP
TVSETTKTSMLVSWEPPSCDGGAEIEGYWLEMKDSDSPRWKKVSRAPITKPPLVGCSYKV
LQLVEGLEYKFRACAVNKAGLGPVSEESEPVKAEDPTFVPSSPEKPEVTDITATTLSLSW
CEPANNGGTPILGYIVEYQDQVKCEWTKLLIDEKELISATTATAPNLTTRLRYQFRVSAV
NKVGQSEPSTATAFIEIKDQIEPASITLDVGIQNVLEVRAGASIKLFAKIQARPVPEIRW
EKDDKLPLPGTAVVKNTDDSSEVTIPNCGRDNSGRYTVLAKNTGGLRTASCKVLVKDTPG
APEPLVVSNVTKRAAKLAWKSPSNDGGSKIQTYIVEKRRADGRGWVKLDSSVSATQFNVL
DLLEGFEYFFRVCAVNAIGQGVYAETSEPILARDPTSVSDPPSHLRVTGVTGTSVSLKWN
VPQFLGNLPLKTYIVERLLREETVQTSTVVIEQTTQQTTEGTAIVQTQTSRSQSKGDNWT
SCNPAKLTETSYTVTNLSDTEKYTFRVLAENEVGVSRPSNSVGPVTCKDDLVYPTIETVE
FKELEAGASIDLFAKFTGKPKPEITWNLQEKEIKNTDRVSVTTDDNSTNVIISKSIRSDT
GVYQVVAKNTAGTCTKNIKVNILGKPTAPELPFTFSSVTASEITVSWMPPKDDGGSRITN
YTVERQEEDRDYWHSVAECKDLSATATSLKKGKNYLFRVKANNKYGASTWTVSDTPCEAK
NQYECASAPGQPQVTGVSRDAMTVFWNVPEDDGGAIISNYILEKRSRTKKKWSKATTDEI
GGNQYRVRGLREGHEYMFRVAAVNAAGQSEFSQPSDLILASAAISPPGPPFPSVKDTTKN
AVSLAWKVPDSDGGSKVKGYHVEMRVADSEDWVKATKHDQRSCEFVVPDLVEGKQYYFRV
VALNAAGQGEPGYIAEAVTIQEKQDLPEITLDASLKDKIVVKAGGVIKIPLYVSGRPQPT
VAWEKDGKDLPEEARVGEAGGSRDLVIRNCQRQHSGKYTVIASNAAGEKRLDVEVLVQDV
PGVCGGPIEPTNVTRDTVGFSWSPPKDDGGCTITNYVLEKRESSRRSWTRVSMTVTRTSA
VVQGLIEGESYMFRVSAENILGVGPGIETSVPITARDPVSEPGRPEELRVTDVTRSTVSL
AWKPPKSDGGLPISEYLVEKRLVGQERQSPATEKMVRDTEVTLEGFNEGDNYEFRVIAKN
DRGTGPPSFPTKPVVCRDIIEPPTLKIDAREKVIVRVDEPYRILAKISGRPVPTVTWEQD
GNTVQTDARFQIKTTPTTSALEVHKGMRKDSGLYKVTVQNEGGQRDVKVILAVVDKPTPP
RELEVKEVTREHVMLSWRTPEDDGGSELLNYVIEKRDISRMMWTTVNSTSLKTDFRVNKL
TEGSEYVFRVMAENDQGCSIPAETQGVVVKDRYRVPDAPDALTIKEVRKESAGLSWSKPY
DGGKAIFNYVVEKRELKSERWVRVTKELINETRYTVTGLYEGNEYEFRVAAENSVGIGAK
CLPSKQIKAENPVSPPGPAVNPHVKGISKNTVTVTWQKPRHDGGAPVLGYIVETQKAGSE
AWKIWCTQETQKTTSYIIPDLTENYEYRVRVTAVNKAGLSEPVMVKGTVVVKERQEAPEI
EVQASMSREQIIKSGLPLSLSAIVRGNPFPTITWSKNDEVIPATNERFERSVKHGIVNIQ
TEASARSDSGRYSLTVENGAGKKTASVIVNVLDTPNAVSHIRISEIRSDSCYLKWKAPSD
NGGAVVSSYKVERYNVESQVWKPVAMAAKKTSLMVKYLTEGHHYKFRIAAENQFGLGPNI
DSDEILARDPIHTPGPPKNLEVSDIDKTAITVSWMKPDRNGGAAVSGYIVDFTELGNEKD
IDDKRKAGINIDTTGEEWTNFKTVTETSCTVTDLKEGVLYKLRVRAINEAGESRPDHTVP
VAPRQKLSSPSIEIDVKTLEGLTVRAGSTLRIPATIHGVPVPTVQWSTADGNVVVTDERI
TCDTDNVSTLLTIRSSLRSDTQEYTLTVKNDAGTKSAAVHVTVLDKPAMPIGPMNILEMT
PEYAIISWNPPKDDGGSPITNYVVEKKDTSKQTWGVVSSKSTRNKCKVPRLISGKEYLFR
VSAENKHGVSDALESKPEVAKHTFDVPDSPGVPEASEITETGCTLHWSAPASDGGSTILG
YTVERLDKESGRWAKVTHDPLLGFTMRVKGLFEGRLYAFRVTAENHAGMSKPSEQSPFIK
ALRPMTTPGAPINPKVADHDCSSATLTWNKPLKDGGSAITGYYVECQRMDIKQSADDQSA
KEWARINTKLIEKCEFRAPGLKENIEYKFRVLAVNEVGEGEPRDIPESTIIKDVLEEPEI
DLDAFMMSTVTYRVGQTVKLTARIKGRPVPEVEWLKDGHAVDLNRYNVQRTAIGTELTGK
ESERSDSGVYTLKAKNSAGEKSVKINVNVLDKPGMCRNLKTSYITKNSCVLSWDNPEDNG
GTDIINFILEIKEPTLPGFSSFGWTIVSSEGTKKMIKCTIVENHEYFFRVSAENKCGVGP
SLELKSPITATDPAQVPQSPRDIKVITTTKNTVELGWSKPDWNGGSPIISYQIVVMKRGT
KDWKEVETNKNECQWKLTDLEEDAQYRFGVMARNKAGVSQVCVTKDYVTVCEDVIMPTVK
ILTTQTKGEILVRAGTDLIIRASMAGRPAPDAVWKLGDVDLFKVARTSIKSTEDETRLTI
SNATRADCGHYVVSASNRIGSDSASAQVNVLDKPGPCVGPIKIISLNKDRCTVAWEPPTD
NGGSEITNYQLEKCETRRMVWSVVTASVTACAYPVPRLLEGNEYIFRVKAENKMGVSQAI
ESSPVVAKSPYDKPGAPDVPEITKIGNGTATVAWKAPEKDGGRDISGYYLEKREKKGVRW
SPCNTKSTMERRLNVVGLSNGYDYQFRVAAENEMGVGQPSEPSKMVTIKEPTEVPGPPSN
PKVVDTTKTSVTLKWAAPAYDGGTRILGYVVESSVEGLDDWRKCNVGVGTPKTTEFVVTG
LRQEQTYVFRVAAVNEVGQGKYESVPGAVKPVEILEEPEIDLDADMRKNIEIKAGSTLRL
LANIRGRPKPSVKWTKQGATLSRRADVDVTDLKTTLVVPDSTREDTGKYTLTASNAKGSK
SININVKVLDTPGPVSNIIVKDIKATSAQISWTPPDLDGGSEIINYVVELKESDKKTWSV
ATTECPKTAFRVTKLVEGKDYYFRIKAENKYGVGVPAEIPKPVRARHPITEPGPVNKLKI
TDVTKSTVTLTWVQPDHTGGSKITGYVIEHQGEGSTNWSEYRTVSDTTVTVVNLSSKKYK
FQVKARNEELSGPPRETDVVDVKEPAEAPKITIPKEVKVRSGKKLVVEAGITGKPHPVTY
WMRKGVELVESEKLLIQKTSSTVSLTIPKAERHHSDEYIIRAENAHGKKQGTVKVEVLDR
PAPPTGPVEFKDINIDTVTLLWSAPEDDGGCPITNYIVEQSEADHPGFKVISSTVSRTTL
RVGKLNKDSEYVFRIKAENKCGVSDVLSSAMVKATYPFTVPGVPCNLDVVKIGKESVTLS
WDVPEVDGGNPVRGYNIEKKELNSLLWTPVNKSLVKRREVVDNTLLEGIEYQFRVQACNT
AGAGAFCKPTEPQVARDQCDAPGKPDVIDVTDTTVELGWTAPRSDGGSKIAGYIIEKQKL
PSEKWVRHITTRGPQTAVVLENLDEGERYCFRIIAKTAVVVSKPSEPTDATLVRQAIAAP
GIVLDASCKDLLEVRAGQDIVIEATIAGKPKPTAVWNRAGGEQIKPTSDGSIVVENVLNQ
SRLIIRSCKRSDAGSYVLTLENTSGSTSATAKVRVLDVPGMPEGPAKFSNVLADRLKLTW
SPPLEDGGAAITNYVVERRETSRPTWAMVSGSAQSTELSVQKLIQNHEYEFRISAENKYG
IGQALVTQPVVAKNPFTVPSAAEPPIVSNATKEGMTVAWKSPSDDGGKPISGYYLEKRET
KAVQWAKVNRRPVSDRSIKVTGLIECAEYEFRVAAENAAGIGAFSAPSTPATADDPKYPP
GPPAFPKVIDTTRSTVELSWGKPAYDGDSPITGYVVEMANPESPDKFDRVATTHITKYTM
TSLSDGREYRFRIKAVNTIGESEASEVPGSVAPKDILEPPAIDLDVSMMKALVIRAGNTI
RLYCGLKGRPAPRASWAKLGDELTMNRVEVKTSDWDTTLMVPNCNRDDSGKYILNVENTS
GTKSATVIVRVQDTPGAPGPIVFKEVTLESVSMAWEAPNNDGGSVITGYVVEKRESTRKA
WATVTAQCSRTSWTINKLEAGKSYFFRVMAENEYGVGVPYETPEPVKVTQEPGPVQRLEV
VETTKSSATLNWLKPNHDGGSRLIGYIVEIAPKDTDDWDVAAEDVKVLSYKITGLSDGKE
YSIRVSAKNQAGTGQPRERNLVARDETTLPSFDLTELPNMTFFAREGTSAKLKLPVQGAP
KPEIKWSKDDEDLKQDTRVSVEDTQISTVVVIKEVRKVDAGKYSVAATNVVGKKTAIIKV
VVVGKPGVPHGPLQISDLTAEHATLTWNAPKDTGGSEITNYIVEKRDIATGTWSLVTSSI
ARPTCRASGLIGGNEYTFRVMAENRFGVSSPLLSETVVAKYPFNVPYAPAAPEVTLCKRD
SMMVQWKPPRKDGGSPVTGYIVEIKERNSILWKNLCKTHTTECRALNLNEGLEYQFRVYA
LNQAGQSEPSDASAVKYALDPVGPPCRPIVYDSTNESISVRWEVPKFDGGHRIVGYDVER
LNLPGKNWVRCNVGNISATNFEVTNLTPGSRYDFRVRAKNSAGSVSEPSETTGATVCKEE
YEPASVSLDLALMDGLVVRAGEDVQLHGITEGKPLPKVTWSLNEKELRDTDDIKIERSIA
QATLTIKNIRLVNGGNYTVTASNHYGSKSATCRVQVLDKPGAVTAPVKITGMTAAKCKLS
WGAPQNNGGSTITNYVVEKRETSRLLWTSVGDAGMHCEMNCQKLITGNEYIFRVSAQNKY
GVGPPTESQAVVCKNPFDAPGAPGKPTVTKSTKTTMTVTWDRPESDGGSEILGYYLERHH
KKGLKWIRCNHEPIRENRHRVTGLTEDYEYEYRVSAENKGGVGPLSDVSCTTIARDPIYE
PGVPGAPRVTDTTKTSISLAWSKPTHDGGAPVSGYVVEMAKEDGDDFEVVSGAQPIGSPE
FVVTSLMSDLKYKFRVRAVNEAGKSEPSSETEATNPVEIIEPPAYELDADMKQALTVRSG
GSIRLFVTIKGRPTPTATWTKEGGLDTDRTDIDTTSSYSLLVVNNCNRHDAGKYELVIEN
TAGSKVVAVNVKVLDSPGPVQNLGVQDVTRSTAFIMWDTPKSDGGAVVSNYIVERRLSTR
KAWTTVSTEVNRESYKVTGLQEGEQYFFRVLAENKYGIGEPAETREVARTAEVPGAPKSL
DLTDISKTTASLVWTKPDSDGGSPITSYLLELQRVGMETWITKSTTSAMKATINDLNEGA
EYNFRVRAKNSIGAGEPTQTLHSVVAKDDIIKPGVDLRDLYMGTITAKAGTNVRIKVPLI
GKPLPTAQWKRNEETVRETQRVNTDLGDGCTILNIKDCQRTDAGTYDIVVKNAAGSKTVP
LKLTVFDRPSMPRGPIEFTNVTADALNMSWQVPEQDGGAQINNYVVMSREKESDKWIEIA
GSVARTSLKVGRLTRDQEYIFRVFAENRFGRSEPLDSKAILVEYPFKRPGMPGQPEVAKC
TRDTVTLTWDAPTSDGGDKIFAYHVEKKDRNAILWTPATRAPAKDTSLKITALTENLEYQ
FRVCAENLAGVGKFSRASESNICRDSVDKPGRPNILEVGRNSVSLEWAKPEYDGGAKITG
YTIERRELPDGRWLKCNFSNVIDTQFNVTGLTEDKDYIFRIFAKNAAGAVSEASDLSEAI
TCKDEISPPRVEFDAKLRDVLTVKAGDNVKLEAKISGKPFPSVRWSKAGEPLEDSNLLNI
INADSTSVVHIRDCRRTDSGQYTIDLKNIAGSRSLTVSLKVLDRPGPPENVTVADVTSSR
AKITWSAPRDDGGAHVTHYVIEKRETSRLAWTLVSNQAEGTSFRVSNLLEHNEYIFRVMG
VNKYGQGEAAESQPLKAENPFTLPGKPSQPEVCNVTRDSCVLTWTRPITDGGSEITNYIL
EKRERRGTRWVRATRKNITECRFRLTGLPENSEIEFRVAAENAAGTGEPSDASSYTTIVD
PIYPPGPPSNPKTTETTRKSATVSWGKPMYDGGSEITGYAVQYAEVKGEVEIEEDAWIKC
PLPARYSLTEYTVCDLVENREYRLRIAAVNNAGVGEFALVAGKVVAKDILMAPDVEIDAS
LRQALKVKAGNSIRLFSTYRGSPAPMVTWRKDEGKLPDLCHVDTTDSTTLLLIEDSTRND
SGQYSLALENSAGSKTVTVNVVVLDTPSAPTALAAKDVTKESVTLTWSPPANNGGSVVQH
YIVEKKETTKKAWATVTMTCVRNTFKVLNLNEGMSYYFRVMAENEYGIGAACETPGAIKA
SEVPSAPGRLEVTQTTSNSVSLAWTKPDTDGGSKVTGYLIEYREASAESWKQAAQVKTIA
GTVTRLSEGKEYYFRVKALNENGLGDHREILQPVVVRDEVEAAEIDMGGLSNLAFYAKKG
DDLKAKVALRGKPLPVAVWKRDSADLRQTSRVNVDAFENYSLLTIKDCIVDDAGVYEIIA
TNPLAKVNAQVQIVIYDKPGAPQGPVRFDKVTADSITLSWEAPKVTGGCQISSYIVEKRE
ATSTVWTMVSAACARNTVKATKLVAGTEYIFRVKAENRFGVGPMLTSEPVTAQHPYKTPG
TPTQPQMCRVTKDSVTLRWSEPVNDGGSPITGYHMEHKDRNSILWMKTNKTTISETEYRA
SGLDQGLEYEFRVYAENAAGISKASRPSELAHCRDPIDPPGKPEALQVGGRYVTIEWTKS
MYDGGSKLIGYNVEKRELPDGRWLKANYGNVSETHFKVDGLSENRKYEFRVFAKNAIGSV
SEPSEISSPILCRDELEPPSLEYDQSLRDTQVVRAGDTAKFTIRVYGKPSPSVRWCRDGR
DIDQSPRVKFDHSTTHTTLTIGDTTRNDTGQYTLLLSNDAGERSLAIQLKVLDIPGPVRH
LAVEDITATKCTVTWDPPCADGGSNITNYIVEKRQTSRITWTQIASDIQARYIKVGHLMK
DNEYIFRVRAENKFGLGDVTESTPIVTKNPFKVPDSPSNLQISNVNRKSLILTWDRPTED
GGSEVTNYVVEKREKLGSKWFRVTSRQIEECRLKITGLQEGQEYEFQVMAENAEGVSQPS
ASSESVVLRDPIYPPGEPRTVKVTDTTRSSISLSWSAPTFDGGSDITGYTVEILPEDAET
EDWLACTSSSGSISTQYTITGLQGEKLYKIRVRAVNAGGSSEPAQLATAVQPKDVLIEPE
IEVDADVGQFVSVRAGGTIRLFSIIRGRPTPTAKWSKLDGQINEMAQIETTVYSTLLLIN
NCSRSDAGRYVLTLENSSGTKTVSITVKVLDTPGAVKNLKVTEVTRDHAVISWEMPELDG
GSVVSNYLIQKRETTRKAFQAVGSTPHRTSFKITGLVEGDSYFFRVLAENEYGIGVPCET
TQAVKISEVPSLPEQVEISDITNTSATLSWTKPEHDGGSPITGYVVEHMQKGGFESWTVG
GSTKNMKLVVGKLNTGKDYVFRVRAQNDVGISDGRETNTVNIRELLIAPNVDTSKIFNNT
VCEKVGTNIHIKVPYSGIPTPTAQFLRNGEPLKQTSRVNSVTSDGVAKLNIGEVTRKDAG
EYELVVKNSVGTKTATLRVVVMEKPGPPTGPMEIKDVSAESITVAWAAPEEDGGTPVTHY
TLEKLDSNIGWTEVSGFVVRTSQKVTRLTTGQEYVFRVKAANKFGLSDPLDSQPIMARHP
FNKPGVPSPPQIVSVTSDSVVISWQEPTNDGGSAILGYHVERKDRNSIMWTKANSYIVRD
TTFKCGNLSQGLSYEFRVTAENLAGMGKTSKTSDAVITRDPIEPPRDVHVTRVNRTNITL
QWRRPEYDGGSKVTGYIIEKADVPNGRWMKCNFNKVIDQTFEADGLIEGKTYEFRVIAQN
AAGSVSKPSESTGSVTARDEVEPASVDVDAQYRDVVCVKAGETFTLKTHINGKPVPTVSW
EKDGKEFVSGPRISILTTDVTSNVTVKDCRRTDSGTYTIKVHNAAGERSIGINVRVLDTP
GVCESVTVTGVTAEKCSLSWQPPKLNGGAKITGYTIEKRETSRLAWTVVVYGTELTQHKV
TGLIRGNEYIFRIRAENKFGLGDHAETDAVAAVDPFVAPDAPGAPEVSNVMKNSCTVMWT
RPESDGGAEIAGYIVERREKNSARWHRVNRRLVSDLRSRVTELKEGSEVEFRVYAENRAG
VGQASESSGFVKLMDPIYVPEAPGIPRVTDSTKSSVSLRWTRPMYDGGADIIGYSVEYAE
VSEKEEDEDFDQEAVVWGKAVDKTCLRNTAYTITGLVQNKSYRFRVCAHNSLGASAPAIT
ATKVVPVERFEPPTFGPDTDLRKTLSVRAGGSVRLAVPIIGRPAPSVSWSRTHNGLKERA
IIDTTDTMTTLLIENVTRDDTAKYTLTLSNQSGTIAASVMVKVLDTPAAPEELAITGMSK
SAISVSWKAPEIDGGSNITNYILERREATKKAWSTVETACARTSYKFTKLNEGFRYYFRV
MAENEYGVGAPAQTEHPVRASEEPGPPKSIQCTDITKDSVSLQWQKPDYDGGSEILDYTI
EQQLKGFDQWTKVKVVKASLHNYVVTHLNENQQYTFRVSARNDTGTSPSTELSGYVLVVT
QTAPPDAELGGFSQKLVEGKAGTTIQASIVIKGKPAPTTEWKREGEELKMTSRINYETVG
NQAVLTIKDAELKDAGNYQLLLENSVGSKTIPVVVRVLDKPGAPKGPVEFSGVTSDSLVL
SWSSPEADGGAAVNNYIVDMRETSGDATEWRMISGSTARNSLKVTRLIPGMDYAFRIRAE
NRFGIGKGLESGSIKAQFPFKTPGSPSAPTIIATTRETMTIKWEAPMNDGGSKILGYHIE
KKDRNSILWMKCSKTLLSSTEYKITNLQEGLEYEFRVYAENAAGCGKTSKPSDSAVARDS
VDPPQDVEVVGITRNSAHIQWKKPEYDGGSRVTGYIIERMEVPAGRWLKCNFSNVSITNF
NIEGLTEGTKYQFRVCAKNAAGAVSIPCMTILPVLIKDDLQPPTIDMDARFAELITVRAG
RTIKLEAGIRGKPTPTITWKKDEQEFKTTGRIVIRNTDISSCLEISDADKEDTATYSLTV
QNFGGSRSLSIQVKVLDKPGAPTGPVQVTGITAEKCTIKWSPPKRDGGAPITNYVVEKRE
TSHLAWVLVNPSVEGTMCKISKMLAGNEYIFRVRAENKYGVGDALESEEILAKNPFSTAS
APTSVEITSVNNNSVTLAWARPKHDGGSEISGYVIEKKIKSGLRWIRANKKPVLDMRYKV
PELSENQEYEFRVCAENAAGTGPMSEETPYVLIQDPKYPPEAPINLRVEDTTKSSVSLSW
IPPTFDGGSEVMGYVVEMTVTKKRRTHSQSSTSTVMTTTTITTVDGVEEILDDEQRLDIH
REWTQVSGKTLVQDTEYVVTGLKDKTEYLFRVAAVSKVGTGTKAMLRMPVMCVERLEMPE
LVIDETVRRNVTVKAGNQVRLNLGFRGRPAPTITWSKADTSAESLKQRGIVETTPYTTSL
TISDSTRFDAGRYMVTVENSEGSKDFAYNVKVLDTSGPVTDLQVVEMTRDSATIKWTTPE
NDGCSVITNYVVQKRESSRKAWTTVSSECTRNTYKITGLTEGDTYKFRVMAENAQGLGVP
TETSEAVKISMKPSSPGKIQLTDVTKSTVSLEWTKPEHNGGSDITGYVVEMVLSGFEKWQ
QCASVNALSTTLKGLEEGRQYQFRVRAKNDKGLSDAATLNHIVTIKDIVEGPIINLRDLP
VGGIHSKAGTSINISIPVSGKPKPEILWKKNGEPIKQTTRVSTVSSAIQTSISIKSCKLE
DSGKYEITATNASGTAKGVLSIAVLDKPSKITDLSIESVTENSVSLVWQPPQEDGGCQIS
NYVVQMRDAESDVWVDCAATAVRPRIKVNKLTIGKEYQFRVSAENRFGCGEFVASEKVLV
KYPFSKPGPPGIPKSTLVSSDHVVLHWHEPVHDGGSPIISYHVEMKDRNSILWRKVNRMD
VRETSFKATGLQPGLTYEFRVYAENAAGCGKPSQSCDPVVARDQISRPLAVEPTGVTRTT
VDLVWRKPENDGGARISGYVVERRELPSGRWLKCNFSNLIECKYTVTGLTEDISYEFQVI
AKNAAGSVSEPSEPSEQVTCKDSFTPPRLDLMGNLKDTIVVKAGEAITLAASIFGKPCPT
ATWSRNNVELDNTPKTEITDTGSTTTLSIKDSTRDDSGDYVLHLKNTAGSRSISITVKVL
DKPGQPIGPLAVSEVTSEKCRLSWRTPENNGGAPVTHYNLEKRETSRLAWTLVESGIEGV
TTKVHRLLKGNEYIFRVIAVNKYGPGVPLESVPVTAKDPFTTPGAPGKPQVSTVMRNSAV
ITWARPSTDGGSEINGYHIERKERNSLRWTRAVRRAVPSLHHKVTGLSEGAEYEFRVSAE
NAAGIGPTSECSSPVLCKEPVYVPGPTGMPKVLDTTKRSVTLAWAAPSFDGGSNVTGYQI
EVCQKDADTEEWAKCTPPTGIKTTEFTVPDLQQNKEYKFRISALNVCGIGEAVQLPIAVE
TTDRLEAPEISPDGDLRKNLTVKSGSPITLTVPIRGRPVPTVRWSKEGAPSVGERTQLDT
TETGTTLFIPECNRSDSGKYTLTLDNSSGSTSASCSVKVLDTPGPCHNLSVKDVTKDYAT
AVWEPPTNDGGSHITNYIVEKKETGRKAWSTITTGCQRTHIKINLSEGLTYLFRVMAENE
NGIGVPVETSTPVKATEVPGAPDRLEVVDVTRSSVALQWNKPEVDGGSKILGYIIESLEK
DQNKWVKRITVKEPLANITNLKEGQEYAFRVVSLNEVGASDPREASSLVLVRDTFVAPSL
DLSQLPHSVAHVKAGDNLDVRVPYTGKPKPTIKWVKDNAKVRITKRVDTDSDEEGIASLK
IQTVTQEDAGIYELHAENQGGKRCAKISVIVLDKPGAVEELQTSNVTESSVTLSWKAPAF
DGGSAISCYVVDLRTSEEAEWRMVSSAIVRTTFKCTKLDLGKEYTFRVRAMNRFGLGPVS
CTEPVTIELPYKVPGAPAACTVSYACKDAMVVNWQEPVKDGGNPVIGYHLEVKDRNSILW
KKANRGIIRSTHYRVLGLQEGLEYEYRVSAENAAGVGKPSRPSEAVFARDPVDIPREVEV
VDITRSTCLVRWKKPEYDGGQKIVGYNVEKRDLPAGRWTKASFNIIPDNEYLVTGLNGGA
EYEFRVLAKNAAGIFSEPSASTGAVRCEDDFRPPRINLDAHLLDEVTVSAGSTLRLHAGI
SGKPEPAITWSLNGKDIREDLRHIIDTTIDHCSILIKDCSKADSGVFTISAKNACGEKAA
NIKVLVLDKPGSPTGPVKFSRISDSRVTCSWEAPEQDGGSKITHYIVSKRETSRLAWSVV
SEKEDLCTLTVQRLIKNNEYQFRIQAVNKFGVGEPLDSEPVVAKNSFTEPSAPGMPDVNN
VTATGCTVMWRRPESDGGADIDGYILERREKKSSRWIKCNKKDLRDLRFKIANLSENNEY
EFRVAAENAAGIGAYSPISLPVVMRDPIDVPGPPSSPKVRDTTRTSVVLSWSHPAYNGGS
AVIGYIIESKIVEDEEQEPQQQEEDETSSSMAEEKGWNLVQSNVLGTKYTIDKLNHDTIY
RFRVSAINKGGVGFPAEVVGAIKPVDRLDPPEYDLDASLRKTVLVRAGNTVNISIAVKGR
PTPNVTWTKDNVNVTTNPRVHVDNVDGKTILVVQDCTRNDTGKYALALENASGVANTFVS
IRVLDTPGQPGSLKVKQITKEYAIITWDAPLIDGGSEVFNYHVDKRETTHRAWSSVSRDC
KRLTWKIDGLNKGSSYFFRVLAENEYGLGVAAETEAVTATEIPDSVNDLRIEDITNKSIT
LTWSKPDSDGGTPISSYIVEYRVKDAEKWTSVKTRHTSTVLEKLKTGEKYEIRVAAENEA
GPSEWALIGPLVAKEQQILPEADLSSIPGRSINMREGGNIRLDIPFYGKPSPSIKWSKDR
IPLKQGERVAFERMRDVALLMMKDVKKADAGQYILHLESAAGRKEAAFTLNVYGNPGKIK
GVIEFLEITATSIVLKWSPPEDNGGSDITNYIIEKKETTSDTWSSVNANCSRTTVKAIKL
NQNSEYVFRIAAENKYGLGEFTESPEVVAKYPFRNPTVPPQPEVVEISADSMTVVWMECH
SDGGSEITGYHVERKERNAILWTKANLATLRTREFKATGLIEGLEYQFRVYAENMAGRSQ
ASEPSKPERAHNVVSPPSCPDWTDITRDSVTLVWKPPKSDGGSKIIGYNIEKRSGADGRW
LKCNYTNVQECEFTATALNSGEKYQFRVTARNASGTVSKPSIPSAEVVCHDDFQPPMIQL
DTDILDGVSIRAGVTLRLKATVTGKPAPKIVWTQDGKELVSNAQTEITKNKNVSLVTIKD
TSRLNSGTYVITARNPCATKDMDVKVTVLDKPGPPEGPVKFTSLTKDKVTLWWGTPKDTG
GATIENYVIEKRETTRLNWALVTACCESTNQTVNRLIKNHEYQFRISAQNKYGVGAPLLS
EPVVAKVNYTVPSPPGQPQYSSSTTDSITITFSRPTNDGGNDIIGYNVERREKKSMRWVQ
VTKKLTTELRCRVPALTEGSEYEFRVFAENAAGPSKPSETSSLIVCQEPIGPPGAPGVAR
VTDTTRSTIALNWTPPMYDGGSIVIGYVVEARKVVAQPQQETEQQTEQTEEEDWIRINPD
FIRSCEYIVPNLQAGAEYNIRIRAVNAAGVGEATPVSGKIMATDKLEVPDFQIDADFKSH
YVVRAGASLRLFVLYHGRPRPSVTWSKPGTELQDRAEIQTTDYSTLLLINSTTRDDSGKY
TLTLENSAGEKKLHLTVKVLDTPGPVSRIGCKEVTSNSITINWDAPLIDGGAIVKNYIIE
KREVSRRSWQTVATKCSRTSFKITKLQEGTTYLFRVLPENEYGIGVPRETETPITATEVP
AIPGRLDIDSVTKNTVTLSWTKPEYDGGSRISSYLIEVSEKGSGKFTDCGRVKGTVFRHT
ITNLHEGSEYEFRVRAKNEAGAGEAREAFSSVITKDELVVPEADIRHIYHKTVTVKAGSP
IEVNIPIIGKPQPVVSWMTNGKALNESDRVAMKTTADSTSLRVKDSKKTDAGTYTMLIKN
NVGEKSYKLEVVVLDMPGPPAGEIQFLNVTADSITLSWNPPTDTGGSEITNYAVDYREFG
RSTWSPVTSCTTRTTVKVNKLQRYTEYQFRVIAESKYGLGEPLLSEICRADYQYTAPRQP
GTPEVREVTKDTVTITWMEPTHDGGSPITGYYIEKKEKNSILWQKDTEKATPKLTHTIKG
LLEGLEYQFRVLAENEAGISKPGDASRPVEVISAVGPPYDLEIVDISRHSAILQWKKPLA
DGGSKIAYYFIERRHVPEGRWLKCNFTNVTATTFEVTGLTPNDSYEFRVTARNTIGTMGQ
PSEVLGPIVCKPKYKAPTIELDSRFMSDVVQIRAGNVLRLEAEISGKPQPNVFWSKGETD
LEDNEKITIVTAGNSTALVIKDISREDSARYTLLLRNECGEKRTSINVKVLDKPGRPKGP
IAFSRVTAEKCNLSWERPEEDGGAEISHYVVEKRETSRISWIAVHETLEHTSCTIPNLIV
NNEYIFRVSAVNKYGQGKPLESEPLVAKNQFVAPDAPGQPEIAAATKDSITITWTRPVND
GGSDIKNYIIEKRDKQGYRWIRCNKTQEVTDLRFKATGLRHKSMVEFRVAAENAAGIGAF
SDASVCGCVQDPVFAPAAPVHLKVTDSTRSSISLALAPPLFDGGSPVDGYIIEVTECKAE
HADEWQKIHKSNYIQSTEFTATGLKHGSEYKFRVFAVNVNGVSEEPATFTDSVFAKEIVE
EPELELDDTFRKTVNVHAGKPLRLYVFVKGRPTPSVTWTKAPHGEELSSRAFIETHEAAS
KLEIEKVDRHDAGKYTIAVENASGRKEASISVRVYDTPGPPGPIVIREVTRNSVSFAWES
PEIDGGSAVRSYVVEKRESTRRAWSTVTTKCSKMSFKINDLIEGVSYFFRVLGENEHGVG
EGRETENAIKISEQPSVPASVEVTDVTASSVSLAWERPEQDGGSRIEGYIVEVMEKGKEQ
WIRAGKTKEQHYTVKGLKDGLDYYFRIRAKNESGLGDARELLSSVTVKEQLASPAVDMSS
LPQKTLNVKAGSPIQLNLPISGRPAPTAIWTKNEQPIKEDLHRTTVKSTATNASLEIRES
TVEDRGDYRITLKNSSGTCTQLIRVVILDVPQPPEGPVEVSDITSTSMVLNWKLPSYDGG
AAISNYVVEKRESHRPNWVCVSGTVTRTNMKVTHLNEDSEYVFRVLAQNRFGVSKPLMSD
EVVAQSQYGLPGATGAPQVSSVSKDSQTIVWMEPVNDGGTEITGYIVERKEPKASRWIRA
TRTPITQTRYVSSGLIEGVEYIHRIIAVNAKGEGKPSKETSPATCQEPVAPPSAPRNLRI
VDMTKASLSVAWDKPEYEGGSKLLGYYIEIRKDGSWWERYNATPIRITEYTLKGMPEGDE
FYLRILAINAGGFRTTDGNGNAIVVKDQSGPPEVLKSFEEPIVVRKGGVISLRVPFKCRP
SPQATWKKISGPEVDLNLRAMIALQTDVAELVIKGVDRRDAGEYEVTLSNKLGEKSVAIR
VQVIGKPDAPEGPLQFGDMQATSLNIVWKPVINDGGSEVTNYVVEKREVGKTAWTTVDSK
IRSTQCCAKGLTEGSEYFFRVFAENTFGLGDALQCTETVTPKNPLFTPQPPQLVEINEVR
KDKVFLAWTRSRDDGGSRVTGYFVERKEAGSDRWVRVNKVLTKNLSFTVQGLVEDAEYQF
RVVALNDVGEGEPSEPTELIQCKDPFDKPSCPEDIEVHHVTKDSVTLAWNKPEFDGGKGI
KGYAIEHREFGMTIWKQSHEDMIRDRIYQIGGLDQGAEYEFRLFAINEQGKSRPKMMEMP
VATKKAAGEKPEIVEALTTVVGVRESTATLTCKVSGRPMPDITWIRYGKELQSGRKYKMI
SEGQVNQLNIINCCDEDEGCYSMVAKNNVGSADTEGKVVVEGVPVLDNRNLRFKDHVIGK
NGQTLRIHVPYTGRPMAQVVWSKEGRRFDKSDRHEIETTETYTHLVIKTSDRTKDVGKYL
VKLTNAHGHNVYSINVEIQDVPHPPTNVEVSDITYKSMVLNWKAPEDDGGAPVSNYIVEK
RDIEDEEGKWSLVTSRVAQTSYKVERLVEKHAYYFRISAENCFGVSKPLETDAPVAAKPP
HNVPEQPTQLMVSGVSKTGCTLNWKQPKDGGSRITNYTIQRRDTKRPRWRRINDETHTQS
VYNVTGLVEGISYEFRIIAENAVGPSEPSDVSEQVLPKDDIRIAAPKFAESIRDLVVKPN
SNATFSCKVTGQPKPIIKWYKGGKEMTGCSQYKISEAKGNHYTLVVHDVTTEQEGPYTVR
ATNQGGSISQTVDLIVQLPAKVNLPKYMMTEATVCKVHEVVSIKVPIEGRPQPDVTWTKA
GKLVSADHHRQFITTSSFTSMTITNAERNDSGFYNVIVKNRFGTNQATVELLVGDVPAKP
ENLKVSNVTRDSVDLTWKEPSDNGGKPVLKYVIEKSTTSSDRWLKVSSSGTCKYTVCNLS
GKTGYLFRVLAENEYGQSKPSGPSDAVTTKEDRMMAANYDDMVDATEKFVATEAVVNKSS
VLDKYQIMEQLGRGTFGTVHRAREILTGKTFAAKLCRFTDEAEKAPINREVAIMRKLQHP
RVLQLHEVFDTKGETALVVQFVSGGDLLERVIATKFELNENVCAYLIKQVLEALAYVHSQ
NIAHLDIKPENILFVTRKSRKIKLIDFGVSRELKTGEGLRISYGTPDFCAPEVVQNDTVG
CATDMWSVGVLTYLMLTGLSPFQGENDNETLRNVAEADYNFDHEAWRFISDDALDFIDRL
LVKEKRERMTADDALEHPWLRTLHPEVDEDLIERRSVAIQTTLHRKFYQTIKKQDTSTVI
ISLGRYASGGALRSLKGKSVAKVKVQSVDMTPQLMPMHHVFVKEKDDAKLTCRIRDADDD
ETITWYKDNLKLEEGDKYEFSYDTHTSSASLYVKGIVRTDDGTYKCRVENAFGSSTQICE
VCVELKTREWTRTRRSIYLNRHKKRGRKTAASEISRIIKCPPEFTLPLYNRTVYTGDTAL
FTITVTVHPAPEISWFHNGQKIKINPDDTHYSEIREKGLYTLEIRRCQLEDSGEVIVHAK
NAYGEDECKAALVVQDKPLKEDLSVRPMFRRLLANQEVDESENARFDIRVTGFPKPTIEW
EKDGKPIRPDHHHDIEWEDMHSCYLLIRDTFQQDSGQYKVTAKNSAGTASCQATLQVHAI
TYQKRKKARKDADLFAREKAYQLADKVSVLKGESVDVRFNDAAKEALLTASTQGMFHREP
ISDSEQKLEKERIKEERKRELNLRMPYVMPEPLQRSEKSLKEDPALTNFVPLSDFKWYKK
VRDANEVYHPTDISRDERRSYRVRRQFVPDVAYIVPDKRIGSTRRERPRVIDDIMIDDYA
RHREPTLSPDEEEIPQRKRHRSFSPGRKHHPRPFVPPAWKQYFKPMSDDEKVLQPVQSYL
DQTTANEYMQEMEQRGEEPRREEFKSYSELLREQRESLAQREVKTVEQEDGIYQYKPIKI
PKRDPYSQTYQELRAKHDSAVSRTKKLKTTELTSGKVVDIESDDELLRPVNYDTWKYAGV
KTEADLPTTKPARRQRSTSASSAASESDGDFNYQRKRRERERRRQEQVDEMEIEMEMIKS
ASKKRFTKKARDEEPDYLKKLRRRRSFEFEELMRPVTDVVSKKKKRRPVYSSSSSSSSSE
SSDEEYYRRQQSRKQRKSKRSRRYDEYEEDLSSGIEFTSSRLKARGDQGVTSSAADYAPN
FQLRMRSHVVPAGMSTKLSAFVRGRPEPQITWYRNGTELASGGTKYYVSNIGGVTTLEIV
RCHEGDSGTYRCSAKNYKGETSDYATLEVTGSEFESSASKRGVQDFHVSLDMIDARTSIS
RNRFETVTHLTPANERVESRSSTAFDERGLSRSSGFSPYVTSESRMGSATPSSSAGAPYF
VLQPKSQYVLEGDVATFSAQCDGKPSPKLTWYHDGRIIKDNEKYNLGANRGKRTLEIRDC
RLMDAGNYQCIAESSKGSATTDFTLDVTPRRRPTPAATSVYEKSSPMGRAASRQRRGPMV
VGQLHVELRLDGKVHIECSVSNPDDVKRVEWTKDGAAIRFSSGRMKSETFGACYSLIIND
LFEEDAGSYECELIGTNGGSSTTTCSMSPQSCASMRKKISKLAGTRGHSSMEQSPMSGLM
QHMERSIEQTSKITSFSSKSSSTSSKGNSPKIEALPGSVSVSTGKVLTLTTALSGQAPCV
AVWFHNGMTLNDGDDCGRIRIDSNDTSTTLTILGAKSTDAGKYRLEVASPRGSDAATVVV
QVNI
NT seq 79215 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgcagaacaaacgatgtcggtttccccacagttcatccaacctctgcaaggc
attattgccgtggagggcggatctgcgacgtttgaagccattgtggcaggttcaccgaga
ccagaagtgcgctggttccacggcggggaagatgtgaccggttcgttgaattacgagata
tcgtattcaatggacggaagagcgtccttacatataaacgaggtgtttgatgaagacgcg
ggacatttcacgtgccaggtgtccaatgattatgggaaagcttccagtatggcggagctg
gtggtcgaaaccaccactgttccccctgattttactgaaagattgtccaacgttgaagcg
aaccaacgcgaaactgtgaggttcgttgtccaggcaacgggagtccccacaccacgagtc
aagtggtaccgagagggagcggagattcgcaattccaacgactttcagatccgatgcgag
ggcgatctgttcagtctgacgattgcggaagtttatgaagaagacacagggaggttcacg
gtcactgctgcgaaccaaggaggcaaagcgacctctactgctgttcttacagtgacagga
gacggatccatcaaaagtgggcgaaccgatgaagattcggaacgtcgtatgatgatgatg
acgcatggcgaggacgtgtcggcgcatcaaacgtatcaacataacatgcaaagaagcgcc
tttgttaagggcgaacggactttttcaaactcaccggataagaaatcgacacgaaccgag
acacagcattcctctatgcagtcagctagttcgaaaatgacagggaaatctattttgaaa
caaaggcaccaaagcccatcgccgattagaagcgtgcgcatgagcccgcctgtgctacga
acgactacaactacaactcatcgggaacaatcatcttcgcctatgtcacgcgtacatagt
gtaaaggcgccttcaccatctaggaaacaggacaaagaatcaacacacgaagtgcaagca
ccttggaaatcaggaccgcccgctttgaacgtgcatgattctgcaaaatcagaagaacta
tcacagcctggaactttacgagaggtaatgacttccgatgttacaatggaaagtgaacaa
cacatacaggaatcgaagtctagacaaagcacagaatattatatggaggaattacaagaa
acatcatacaccgctactgctgtacgcgaaagcgcgtcggttcaccaacagtcagtgacc
tcagtcagacaggacaatttatcaatgacatcatcattacgtcacgaaaatgtggctacg
tcactcatttcgtcatccacatcgtcattgtcgtcatcagacaagccaccagcagcaaag
cgaccttacgtcgcacctgttcaacaagttggtagcttgccttcttcagtaagtcactgc
ggagaagttaaaccgatcgctggcgttcataaagtcacacccccatcgcccatggtccat
aggacttcatcacaacaaacaatttatcgggaccttgccgctttcccgccatttatcaaa
tccgggatgaaggatgttcacgtacaagaaggcgatatgacgaaactagaatgcgagatt
atgggaaaccctgtaccagatgttatgtggtacagagaaggagctgaaatcaaaagctct
cacgattttgaaattacttatgatgggcaaatcacccgcttacttataagagaaactttt
gttgatgatgccggacatttcacttgcacagcatcgagtgttgctggttcaacctcgtgc
acatgtgtactaaatgtaacacagcctcagacaaaacctgaacgcgccccttcagcttct
gaaactgaactttcaatgacagattttgatggattcgaaagtaccgaggcggaacttgat
tttgtctccggcgtttccgaagccgaacttacagatactgaaatatttaaaccaagtgct
gcggctgcaaagctagtcagcaatgctattaacgccggcgagcccgcgcccggggccacc
atgctttccccggtcgtcgaagaaatgtcaacacactccggaaaagcttcgtcaaagagc
atgcagtcagagggcgctagagtgccgaatgacgtttatccaagcggtgagccgccgcag
ttccttagcacgcccgccagtatggttaaactggttgaaggcgcttcagtcaaactagaa
tgcgtcatatccggcgtaccagaacccagagtgacgtgggcaaagaacggacaaatgcta
caatctggacatcggtttaaaataattcaggacaggaccaaaaacttgtattgcctcgtc
atcggaatggttttcgctgaagacatcggtgaatacacgatctcagcaacaaatcaattc
ggtttcatcagtggatctgtaatgctcatatcagaagatcaatacgcacggtttgaagaa
caagacgcaattgatcgacaatcagttgaagaccaacaacgaggggtaatggcacctcct
tcccaacttccaccccgtggtcgtggggagtcaaggggtcgaggcgtaagacgtgtcatc
gtttcgccagctcgctctccaggcttgagaaaaacaagcgcgagtcctgtaaaacgacta
cgagaaacttcaagatctcccgtccgcacgatgtcgccatcgaagcgcttggaggaaatt
gaacaactggatatgaaaaaatatttcagaccgaaattcttgcgaaaacctgaaagcagg
gaatgcaacgaaggtgaagcgacgaggatcgattgcaaagttactggacgtccattaccc
gatgttactttctacaaagagggctcccaagtttatgaagattataatcaccggattgtt
gtcaaagaagacggcatcagatctcttatcatttcacctgcgcgaccagaagatagcggc
gaatacactgtcgttgcaaggagcgctgctgggaaagcagtcagcactttatcactgacg
gtcataccgcaagaaggaatagaaagaccacgaatcctcgaaaagccacaaagcgtgacg
gtgaaggaaggcgacatggttcgtcttgaagttttcgctgttggcaggcccactccagaa
atcgtttggctcaaagacaacgttcttctcattcctgagaaacacccagaactcagaatc
gaaggtgttgacggacatggacttctaactatcgatcgtgcagcgaaaggtttacacgat
gcatggtatactgccactgctgtgaataaggctggacgagacttgtctcgatgcaaagta
aacgtaaaccgaatcgaatacgatccagaaccaagtcgaaaactgtacattccgaaatcg
aaaggtctaaagcaggcggttgagccttcaccagaacgagttgacctgcgaaagttggac
aactttgacgagactgacttgtacgatagctctcgtatgcaaaagccaagaattaagaaa
aagttggtttcggcaaaacagaagatccttggttctgttcactttgaatgtcacattgta
ccgattggtgatcctaccatgcgggttgaatggctattggatggcaagcaacttgaatac
gcaaatcgtataatgaccacgtttgagttcggctacgcagcattggatattaatgcagtc
taccccagagacacaggtgtgataagctgcagagcaaccaacgcccacggtcaggttcaa
tcatcatgcactcttattgtgaaagaggaacgtggacttgtcgaaaagactcaactaccg
gacacaacccaacttggcaagatagaaacaactgaacgacacagacaagagatttctctc
gcacatgtttcgcatcaaaccgatgaagtcgaagtcagatctgctccgaaaattgtcctg
aaccccgatcctgttgttgtacaagaaggtgaaccagcacgattccgttgcagagtagtc
ggttctcctttgccaaaagtggattggtatttaaatggacaagcaatcagacaaagcaag
agattccgaatttggtccgacggtattcattacttcgagattgcaacagtacgcggctac
gatcacggccaagtcaaaatggttgcacagaacattgaaggaagcgtagaagcgacgacc
acaattgaagtgagccaggccagggatctcaggaccgttctacacaaagctgatattcaa
acctctgattccaaaacgaaaagtcgcatcgacaccaacacgttgaagtcgtacaggatc
acacgcaatgtggaagaacaatttaaagaggaaaaaggtcgacatatggtccctctgcgc
gaagtcgaaaaacccatcgctggcttgaagaaagtaaagcgagtggaaagacatgaagaa
ctgcaatcgaagtttagcaaactatcggaggaagaacgaatgctgaacacgtttgaagct
gacaaaaagaagtcaactcaacgcgaccgtaaatacgagtcgttcattcggaaaactaag
gacagtttatcgcattgggacgaaccaaaaccagaagaagcgcctaaaataccgtttcta
caacggccaaagcaatctctgccccctccttatgaaataaaggtcgatgtcacacctgac
atgcaagctccagttgtgttggaacgtatccacaatgtcactgtacagtcgggtaaagac
gcaaggttccgggttcgattccacggtaaccctgagcccgagatttcttggtacagaaac
gaaattgctttggaaaagtctgaacgtctcggctggatattcccagagaacaacgtatgt
gagctgtttatccgagactgccatgtcgacgattctggatccatttcggttcggatttca
aaccctgctggccaagctggtagtcaaggctttttacttgtacaagaagcggtcgaggct
ttacatttcaccgaatctcttaccgacgtcgaggcaaaggagaacgagaagtcagttatc
tttgaatgctcggtgtctgatttcactgctgaggtggagtggcggaggtgtggcactgac
ggggcggccgaagaagttttacgaaccagtgagaagtttcagaccagggcagatggcgct
caacgtttgctgagaattgctgacatcaaactgagcgatgctggatcttattcttgtgtg
atgttcgctgctggagataaggaaatcaagtcaacggcacaacttcatgtgaaagttgtt
ccaaagaaaatccaatccggcttgaagaaccaggtcgctcgcgaaggaggggcttgcgac
ttcactgccgtagtttcgcatgctggtgttgcaggtacctggatgaaagatggcgttgaa
atacaggcaagttccaagcacgtgatcactgaaaatgggaacaaaagatccctgaccgtg
aacgactcgcgtgcggcagacgaaggagtttacgaatatatttactgtgacgaaaaaagc
ttggcgaatcttacagtgcaagccatgcacgtcagcatcgttaagaaacttaaggatatg
tcggtatttgccggtgaagttgttactttggaagtgaagatatcaagagatgacgccatt
gctacttggtcgcgtaacgaacaaactgtgaccagcgataaaaggttgatcacgacatct
gatagaagccgccacatgcttattattgaaaactgcacggtcgaagacagcggggtttac
actttcgcagcaggaactgcatcgtgttctgccactttagaagttaaatctgtggacgtg
acaactggaatccaagattccaccaacgtcgagtccacggatggtgtctttgagtgccat
gtcaaccaagccggctattctgctgggaaatggttttgtggccaaactgaaatcaaatcg
gacaacgcaaaatattcagtgaaaactgacggcaagaagcaagtgttggttgtacacaat
accacagcacaggacagcggagtctattcgtatgttactggaagcaagtccaccagtgaa
gcaaagctggtcgtgattcctgtagaaattaccggcacactccaagatgtgactgaagcc
gaaacagccgctgttaatttgacggcgactttgtcggaaagtggcgtccatggagcttgg
tttaaagacgggcaaccactgcagaacacaagcaacgtatcagctgttgtggatggaaaa
caacattcgctatttattcgatccctatctttgaacgatcaaggagtttacgaattcaga
atcggcaacaaaactacatcggcctctctcactgtacaaggtgcccaaatcacgaaacca
ctctccgatgctacagccacagaaacagagtctgtaagattcgagtgccaagtggcaagt
gacggggtccaaggttcatggatgaaaaacggggaacttctcgatgcagattactcgcat
cggttcgtcagctcttctgaggggcggacgcagatccttatgatcaatgacgtcacaaag
gaggattctggaagttactcattcaaattcggcagcgccagcacgtccgcaaacttgtcc
attacaggcatcaagttctccaaaggtcttcgcaacattactgtagcggagggctccgat
gccgacttcaccgtcgaggtcgccaacgaaaacatttccaatgttcgatgggaacgcaac
ggtgtcatgatcaactgcgatgatgtgaagtacagagttcagtctcaaggacaaaggttt
acactcatcgtgcattgcgtgactaaaaaggacgaagctgcatacagttgcattgctgga
tcagccaagacaagtgcacgattatacgtcgaagctgtgaccatcacgcgcaaactgacg
gaggttcgagccatggaacatcggaatgttgaactaactactgaagttacaaactcaagc
gttagtggagtttggacaagaaatggagtaactgtcactgaaacagaacgtgttaagacc
acacaccgcggcaagacacaccagttggtcatcacagacgcccaggcggatgattccggt
tcataccagtttgctgttgggaagtcgacaacttcggccaaagtgattgtggaggcaatt
cacttgacatcgcgcatgaaggacgtggtggtgaaggaaacacagaccgcaacttacgaa
tgcgaggtttcccaccctgatgttccggcagctgcttgtaaatggaccaaaaatggagtc
gtgataaaaccgagtaacttgatatccatcaccgttgacgggcgaactcatcgcttgaaa
atccacacttgcgctgcagaagatagcggagagtattcgtttaccgccggcgaggatagt
tgtaccgcagctttgaacgtagaagctgttacgatcgtgaagcaaatgccgaaaaagttg
caagcaaacgcccacgatgtggcggtgttggaatgtacggtagatgcgcccggtatttca
gccttctgggtcaaggatggcaaacgaatagatacaacgcaggacaagtccgtcaaatat
gaagccattagccgagatgttacgcacaccctcaaggtgaaagacatcgcagcagaagac
gctggcgtgtacgagttcgtggctggcagcgtacgaaacaaaactacactttacgtcgaa
gttgttgctgtcgagatcacgaagtctttgaaaaacatcgaagttgtggaaaacaagaaa
gctacactcgagttccaagtcaacaaaccaaacgtgaaagcgcagtggtttaaaaacggc
gttcaaatagacttcatgttaatgaaaaggtttaagtacacgagtgccgatctaacgcat
aagttatcaattgacgaagttgaattcaacgacgctggagaatacaccttcgaggcagga
aaccagaaagctacagcttacctatacgtgcaaccaccagaagcgcccaaattcgtgcaa
gagcttcgcaactgtattgtcatcgctggcgaaacagcaaagttcacagtgcgggcgact
ggacgtccagcacctgaagtgaagtggtacaaagaaggaattacaattacaccaagcttc
aagcacaagatcttgaaagacgaggatcaatacacgcttgctgtcgtcgaagtcgaacca
tcggatgcaggacaatacacgtgtgaagcaaccaacgaaaacggaactttccgcacgaca
gctactctacaagttgatagcaaagtggttatgccagtgcccagcacgccgactgtgtca
ccgcctgccatagttgaaccaatgcaagactttattacaagggagggccagagtgctcgc
ttccaatgcaagattatcggaacaaatccaaaagtgacctggtcacgagacggcaaacgc
atcaaaccttcacgatacttcaagatgtccgaatacaatggggtctaccagcttgaggtt
acggaggcttaccccgaggacgagggaacgtacagtatcactgcatccaatgatcatggt
gatgtgtcgtgctctgcgacgctgaaacttgacaggctcttcaaatctccagtgcaagag
gtggaagaacaagctgcacaagaagatgtacagacagacagtcaaccgaggaaatccagg
tttccaacgatcgtgagcgggcaatcaaacttccagcagcttcaacaaaccgacgtgttc
atgcaacaaccgtcaatgatgatgaaacggccaacagaggtctctgtgcgaggaaaaaga
accaaacccgcgtttaagcgtcctctccgtgatataaccgttgaatttggatgcccggca
agattcgtcgcagtggtgaccggtcacccgaccccgttaatcacttggcaacactgcggg
aatattatacaagacagtcaccggtacaggtaccttatggaaggcaataaacataatcta
gttttgcccagtgttgaccacgaagatgatggtgtcattacatgtacagcaactaatcaa
agtgggcaaactaccagtactgctcgactgacagtgggtcagaacttgaatatttctgaa
ccagactcctacgacgcaccctttgaaatgtcttccagcagtaacgtgacgattgtcaac
agcatcgaatgttctcgaactgacgaaatgtaccactcggtagatggcgcaagtgatttg
gactctgcaacatacaacgccacagccactgatatgcaatggacatctatgagtgaaagt
tacgctaccactatggagatgtacgaaacagaagactcgcagacaacggcaagcgcctca
gaaatgaccactctatccatttcagaactcgattccaccttcagcaaccaaactgtcgta
tctcagaagacacacactcaggcatcgaaacctacaaggaagtcgaaaaaagttcgaatc
aagaaagcgaagcacacaagtactggtcaaggcaacgtcctagacaagtccattgctgct
gattggactgaggaagttcggaaactgatccgtgaagaaattgacgaacgcgagaagatg
caccaggtagtaagacccgaacctgagatggtaaatgataaagaacttgaaaaatcgttg
gctcctcggtttgtgaagaacatttccgactgcgaagttggagttggcgaaactgctcac
tttgtttatatacttcaagctgaaccacctgcagatatattgtggatgagaaacggaagt
ccgatttcactggataagaataaagttggtgatggtgtcaacagcgctactgatggtaat
attggaataattaacgatgaaggcgctggctgtcttgttataagcgaatctgagcctcac
catagtgggatatacgcgtgtgttgcgtcgaacgaacatggaagcacgaagtgtacagcg
acgctgttggtgactgggcatcttgcacatgttgatagagtggaagagatcactatcgag
caacagcttgttcatcgggagtcgcaaacacacgagtcgcgtatggatccagacgaagac
cgaaagatcagagatgcttttatggagctggaaaaagcggagaggatgcgaaccgttgca
gatgttgtgatcgatgaatctaaaaaagacgaagctgttggaaaaccagagaaacaaaag
gttgagaagccaaagcggaagaaaacgcgccgaaaagccgagaaggaattcagcagattt
ggcgacaacgagaccggtgaagaagaaaagttgcaaccgccaacatttgaagaagaactc
aaagtctgcaaagttcgacctggagaaaccgtcaaactgtcatgtacagtctcgggttcc
tcgcccattgaaataacatggaaaagagacggcaaagtcatcgaagcttcttctaggtgc
aaagtgaacacaaacgaaagcaatccatctttggaaataccagacgtctcattcagcgac
gctggcaattactcagtcacagcggtcaaccagtcaggctctgccagttccacggcttca
gttatcgttgaaggagtctctcctgctttcatcgagaaacccgaaggtggtacatgccaa
cttggcgacacctttgagttctgcgctgtcgtttcgggaatccccgaacctgatatttac
tggaaacacaacggtgctccagtaagagacgacaaccagcgaaccatcacaagtgagaca
gggggacagtatcttcttgaggttaaagaccttgcgttagtggacgctgggaaatacgag
tgcgtagccgagaacgaagcaggacaagcttcatcgacggttactctcgttgttgaagaa
gcgacgttggttgatacgcttcgaagtatggagtctaaaaaagacgtggcgcagacaagc
gctaacataaagttcgttgaggaaccgaaaagtcaagatgccgcaacaggcgacaccgtg
actttcaccgcgatcgttgaaggcaatcccgaacccgtagttaagtggaacaaaggtaag
tggagacagatcaagaactacgggcgggtgaagattgctcacgataaagaaacaaacaaa
cataccctcacgatgtcaacgcttgacaaacccgacactggaatgtacagatgcattgcg
agtaacgcatctggcgaagtttcagttcagtttgacttgagggtgaccgaacaacttgtt
tcagaaaaaatggataaagcggaacttaaaaagcccgcgcaaaaagaagaacaaaaaatt
gacgttgcgacaatttcggatcttctcaaagaagtagacccgaaagaatacgagaaatat
gcgagacattacggcatcactgactacagacagcttctttcacgatacgaggagcttcga
tctaaagagccaaaggacgtggaagctgaagccgaagaagtcggtgccctgtacagactc
atggaacgcagtttgtcgattgaccagcccgtagaggtggtgtcagacctgcaggatgtg
gctgtaagaaagggacgcgatgctcgctttactactgaactaaacatcaaagtaccggga
attgagatcaactggtacaagggaaatgaccgaatctacgagagctcaaaatattccatt
ctgcacgagggaacgatgttcacgctcgtggtaaagaatgtatcggataaagacatcgga
gaattccgtattgttgctggacctcacaagtcaaaagctgcacttacattaacaaaagaa
gtttacttcaccaagcacttggagaaccagcgcgtgcgcgaaaattgctctgcagagttt
gattgtgctgtcaatctcgccgacggtgttgtgacgtggtacaagaatgacgtcaaattg
cgcgcttctcgcaaatatgagatctcctctgaaccctcgaccgtggaaggcgagactgcc
cacaaacttattattactgaaatgaaacctgacgatgaatcaacaatatctgctaaagta
acgctcaccggccatggaaccgacacaactgctgccaagcttgagttctcgcccgaagct
ttcgtaaaaccgctggaaaaccgcgtggttaaagaaggcgaaaccgttacgttagaatgc
gagctatttaacgcgaacgatgaagtggtttggctcaaggaagacaagcgtatatatcct
ggttcgaagttcgctttgaccagagaaaactccatgcaccggttaaccatcaacgaacca
atgcagctggacagcgccgtgtactcttgcgccctcaagcgagatctttcacggcgatgt
tccagcagcgtcgcaatcgatacaagtatatattttaaacggattttgaaacagctaatg
ctcgcccgcgaaaaagtgactgcagaggaaagcgaaagccttactttggtctgtaacgtg
tccagagaacgggcccgagtactctggttacgcgatggggttccgcttaaacctggtccg
agatacaagacctcaatatccggcttcgatcgccgtttgatcataaatgacgtcacgaag
gaggtcgacgacggcgcgaagttcgcttgtcggatccgggataacgacgaactaacagag
agtgttgctgaaatctgcgtcccttctataagtgacgacattttgaaaccactcaaggac
caaaccgttgttgaaggcaagaaagcaacattcgaatgcttgatcagccgtgatgatgga
aaagcagtctggtacgccggcgataaacaaatctctgcgcaagacaaaaaatacaagacc
cttgccatgaaaaacctgcgtcgacttatcgttgtagattgcacgcttgatgacaaaatg
acttacacatgcgctgtgggcgatctgaaaagctcggctacattggacgttacacctgct
acccgccaagaagaagcgcgagtcttgcagaaaaagatcaaacacattgaagttgaacct
gaacctgaacaagaagctgtcgaacttaaaccaattgctggccttaagttcgtcaagaca
ttggaaaaccaatcggcaactatgaacacgtcaatcaccctggtttgtgaactttcccac
cccggcgtcgctgtggtgtggtacaagaataaagaacaagtttacgaaagcaataaatac
accatcacggtcgatgacaccaagcatacattgaaaattgttggtctgtcacaagacgac
aaagcgactttcaaatgtaaagcagtgccgaacccggatgttattacaacttgcaaagtt
gatgtcaaagagcaggaacagacacaagatcgaatccgattcattgaggagcttgaagct
ataaactgcactgtaaaggacacagttgtattggaatgcgaactttctgacccgaaagct
aaagtaacttggatgaagggaaacaaaccattggaaattgacaacgatagattccaagcg
ctttcggatggtgcaaggcgatctcttgtactgagagacgtcacacttgctgacagctcg
gcatatacttgcaaagtcgctgacgtgttttcaactgcggaaatattcgttgaagaacaa
ccaacattcctcaaagagatgaccgaccaatactttgaagaacaagcagtcggtattctg
gagtgcgagatcagccgtgcggatgctactgtacgatggctctttaatggagaagaaatt
gacatcacagaacacggaaaacacacatctgaggcttcgggtagaaaacgaacattagta
atcgacgatttgtccaaaagcgatgaaggtgtttacgtttgcaagaccgatggagatgct
gaaacacaggcacatgttagtgtggaagtaaaagacgtcaagttgctgaaaggacttcgg
gatgtgtctgtcctggaaggagaatctgcaacttttgaaactgaaatctcagacgagagg
gtcaaatcccaatggcttcttgatggaaaagagattgaatcgagcgacaatgtcagcatc
atatcccaaggtcgcagacgatcgcttattattaaagaaacaaacgcttcacacagaggg
caggtcactttcactgctggacgtttgaagaccaacgtacacctagctgtacaggaccaa
cctattcatttcactgaacctttaactgaccaaatcgcagaagagagaggacaagccaaa
ttcgtgtgcagaatcagtaggcttgatgctaacgttaagtggattcgcgaccgacgaaca
cctattcaagaaagcaataaatatgaaattaaatcggacgggacttctcgtattttgatc
gtacacgatgttggatacgaagacgaagtaactttcacatgcgacaccgaagatagcaaa
tcaacagcgaaacttactgtcacagcccgcttggttgagtttgtcgaaccactgcaggat
cagaccgttgaagaaggcaaagacgcaacattttcatgcgtgctcaaccatgacgacgta
caggtcacgtggtacaagcggggagttaaacttctgaaaggacgcgacgtaattattgaa
tcggacggtgcaacacaccgaatcacgtttaacactgtgtcagtcgatgacgtaggcagc
atttcaatttcagccgaaggaactcagggtgcagccgagttaaaggtatcaactactgaa
gtggaaattgtccaacaactgaaggatgaaacaataactgaaggagaatcagtgactttg
acttgtttgttaaacaaacccaatgtaataggctcctggttccgaaatggcgttaagttg
gctcgtaccgatttaatcgttattcgggccgaggctgaaaaacatacactggtagtgaag
aaccttaccgttgacgatgctgcagagtttacctttacatgcgatggatgccaatccgct
gccaatgtatccgtgacagaacgaccgatcatgttcaccaagaagttacagccgctcacg
tgcaccgagatggacgtagctgaactttcatgcgaagttagccgagtgcatggcgaggta
acttggtggaaaggcgatgaacaagtagttgccaccgaacgcgttgaactgatcactgaa
agttgctggagaaggttggtaattctcaaggctgaatacaacgacgaagcagattacact
tgcaaatgcgaagctgatgttacaactgccgctctcacaatcggaggtcgaaacattaag
attcgacgtgatttgcgagatgtggaagctacagaaggacagggcgttacttttgaatgt
gagatttcccacgatgatgtcaacgcacgttggtatcttaacggagaaattatcaaggag
tgcgacggtgtcaagattgaaactgttggccgcaaacaccgattaatcatcgaaaaagtg
acaacagaaagagcaggaaccatcaagttcgttgcatcaaaagcatcaaccgaagccgag
ctcactgtgatggaacctttggtggagtttgttacaccgatccacgacttggacgtcgaa
gaaaaagcaaaagcagttttcgagtgcgaagtatcgcgcccgaatgccgaagtacgctgg
tacaaaggaagagctattattcgggattcagaaaaatacgagattcgctctgatggatgc
aaacgtaccttggttgttctgcagtgcacatttgacgatgagaaaaaatacacctgcgat
gctgacgatgcgagaactagcgcgaagcttactgtgcaagcacgagctattaaatttttg
aaaccacttgaaccaaacatgcggattgttgagagagaggaagtaaccttcgagattgaa
ctttcccacaccgatgttgatgtgatctggtacaagaacggcgcgaaaatggctcgaacc
aagaacatagaaatatacaccgaaggcgcaattcacaggatggtgatccaccacgctaat
atggaggattacggggttgaagttgaagctcatgcagaggaagagacatcgatgacaact
ttatatattgacgaaatcaccgtaaagattgaggaaccactaaaagacttgaccatcatt
gaaaaggaaactgcagttatgactacagtcaccaactatgatgccgtaccacatgtttgg
tacaaagatgacatcaagcttgtaaagagcgacactgttgaaatgacggacgaaggaaaa
cttcatacactcaagcttgtagcatgtaaattggaagatacatcagaaattaagttcgta
tccaagacagcagagaccaaagcccatctaactgtgatagaaccgccagtcaagttccca
caggaattaaaagacaaaacctgcgaagagatggacagagtggtacttgaatgtaatgtc
agccgagcaaatgcacaagttgtatggaggaaaaacgaccaagaagtcgaagccagtgaa
aaataccttattgaatctgatggaatcattcgtcgccttgttttggttgatgcagctatg
tcggataatgctcaatggacctgcgacggaaaagactcgaaaacgacttccaacctggtg
gtgaaagaaatcgagatcaagtttttgaaagacttgaaagcaacaactgtaacagaaagc
gaagacacaaagttcgaatgtgaaatcaacaccagcaaagccgtccaagtgcagtggctt
catttcgggaaaccaatcgttgactcaaagaaactgatcaccaaaagaacaggcggaaaa
cttcaacttgaaattaaacacacaacagttcgggatgatggacattacgcttgtctggtt
cgaggagtaaaaaccgacgcaaggcttacagtaaaggaacagaaaaataaaatcgccgtg
cagatgcaaaacgtaaagggggttgaagaacaaccttctgtgacattttcctgcttgctc
gaaaaggaaactgggaatgttaaatggctcaaagacaacaaaccgattgacatttccagc
gcaaaatacgaagcagtgtgcgctggtaaacaacgttcactgttggtcaaggatttgaag
aaatctgacaagggaaaatacacttgtgtgtgtggcgacagtaagacaacagcagaacta
accgtgaaagacggagttaaattcctgaagaagcttactgatacaacagttcttgagaaa
gatggcgcaattttgacttgtgaggtttctgatccagaagttaaagtacgctggtacaga
gacggactaccagttatagattcggacagaatttccgtgaaagctgagggtaaaactcat
actgtttcgatcccatggacctgtttgggagatactggatcatatcaagctgttgcagag
ttcgccaagtgtaatgccaagctaacggttgaagatgcaccacttgttttcctcgaacaa
ctcgccgatgcttcggttgaacatttggaaagtgcaacgtttacctgcaaagtatcacct
cgagaccagaaagtcgagtggtatttaggagagaaactccttgaaggttccgaacgtttc
gtattttcagaagacaacaaagttaggacattgacgattcatcaatgcaccgaacacgac
agaaacaatgtgagttgtaccttcgccgaccagaaaactgtcgccgtcctgaaggtgggt
gatccaccggcgtggttcgaaaaagagcttgtagctttggtttgcatcgaacgggaagtg
atcagcatgcagtgcgagctctcaaggcccaacgttgacgttgaatggctgagaaacggt
accgtgcttggtcaaagcaataggatgcagttcattgcagaaggcattgtgcgaaagatt
gaaattgctgatgttcttatggaagaatgcggcgactacactgtccgtgtgaaggatact
gatactacaacgacagcacatttgacagtgaatgaaattgcacccggtatcttgacagag
ccggttgacgtatattgttgcgttggggacgatattactttcagctgtggcattaccaaa
acccgctacaacgtggtatggtctctcaacgataccgaaatcaacgatgatatgattaag
gaaaacaaaaatcgattcgcgttgtccaaaagtgacggcggtttgacccatacattgaca
gttaacaaggccatgcttactgattgtggcgaagtgaaagctatctgtgaaggaattgca
tcaacacgtaccgcaacactcaccgttgtgccgattgtgtttgatgtaccaccgtccgat
gcagtgatctgcgcaacacagactgctacgtttgtaggaaccactaataaagaaggcgta
aaggtgacatggtcacgaaatggtaaaatactcgaagcaggaccacaagttgctatgaga
gcagaaggtttcaactactacttggaaattaaagactgcactttacgagacgaccattcg
ctcattacagcacaggttgctgaatgcgtggtcacttcaagacttttagtcggtgaacaa
cccgctaagtttgcttctgataaaatggatgacaccacggtggaggaaggtgacagagct
tgcttgtcagttgacctcacccaacagggtggtcgtgtacaatggatggtcgaaggcaag
cctattattcctgactccaggatgcagcttgtagcaaccggtgttagcagaactttggtc
atactggattgcaaacgtggtttggatgagaaaacatacacttgtcgatgcaacggtaaa
gagatctctgcaaagttgatcgtaaccgaagcacctttgcgttttgtacaacgcttatgg
gaccacgacttcgaaccaagcaaaacctgcctattggaatgcaagcttaacaaacccttc
actaatgtagtttggaccgtggatgcaaacgttatcaaaactgaccgaagacacaccatc
aaagtggcagatgatggcaaaaagcattcgctttacattactgagttcagcgaggatgat
cgtggccgatacacagctacctgtacaggaacgaatgtagaaacaactgccattatcgac
gtggcaattgctccagtgttggagattaccaacgaccaaatcaccatgaacgcggatgct
ttatctgaggttactgccaagttcaaggcgatgcccaaaccaaccatttcgtggttaaaa
gaaaaggacgataccttggtttctgttgctgaagacagcatagttgtaaaccaagacgat
acgaaactacgattccgtaaaccgaaactgagcaactccggccgttacaaggttgtagca
aagaacaaatacggagaagacagcgcttacgtaactgttactgtgattgattgcccgcaa
ccacctgctaaccttacggttactgacgtcactgccacgagtgcaacattgacttgggaa
gaaccagaagaagatggcggttcacctatcatgaagttcctggtcgaaaaacgagatgtt
aaacgcaagatgtggcaaactgtatctgatggtgtggaagatacggagatcacggtacaa
aagcttgttgaaggaaatacatatcttttccgcgtttcgtgcgaaaatcaagtcggactt
tcgaaaccaactgaaatttccaacccagtacttgctaagtcacagttcgaactacctcaa
gcaccacagagcgtaactttatctgaagtgcgacgtgaccatgcaattatttcatggaag
gcacctagctttgacggcggatcaccgattactttatacgtggtcgaactacgagataaa
ctgcatacaacatggactcgctgcggtgtcgttgaaaacgactgccttcaatgcgctgta
acagaaccagaaattactcctggaaaggaatatgtgttccgtgttttcgctgaaaacgcg
gctggatccggtaaaccgagcagtccaacacctttgacaagacttgaagatccaattgaa
gcgccaatgcaaccgcgtaatcttcgctatgataacgtgaccaagtcatcactcgagctt
tgctgggattgtcctgagaacgacggaggttctccagttactggatacatcattgaagtt
tgtgacaaagcagaaggtgtttggtcagcagagggagtaattgagacagtcactggtctt
cacttcgtggtttgcgggcttgaggagtctcacgaatactcgttcaggatcagggctact
aacaaagtcggggagggaaaaccttccgatccttcaccgttcgttcttgcaaaagacgaa
acaaaaataccggcttgtgatattactcaagacaaaaaggacatcgttgttgttgaacca
gaacctattcgtgtttcggttccaatctctggtctcccggcaccttctataacctgggtt
cgggtatgtgacggccaggtcttgtgccatagtgaagaccgcgtcagtttggaatcggga
gcaacatatgccaacatggcagtgttgcctagcaaccgtcagcaggacaatggccaatac
agactggttctacaaaacgatcaaggaaccgttgaatgtgattttaatgttacagtttac
agcaaaccgggaccaatccgcaacttgtcggtggcagaagttaccagcacaagctgttac
ttgtcctgggaaacaccggaagatgacggcggttcagagattacgacatatgtagttgaa
cgaaatgaagaaaaacgaaaggcatggaccaagatgaaaggttcttctgaagcatcggaa
tgcagcgtttctgacatgaaaaaaggtaagatttacaggtaccgagtttgcgctgaaaac
cgacacggaaaaggaccatacacggagctttcggagccagtggtcgctgaggatccacca
cgagtgcctgacgcaccaaggaacctgggatattccaacgtgaagaaagattcaattcag
ttgaactggtcgatgccggtgtttgacggtggtgcagctattactggttacattatcgag
aaacgacctgaaggcgacgaagaagcacgctttgtggcagacaaccaaatacctcaccgt
gagttaaagtacacgatccgaaacctaccaacagatacgttgtggtgcttccgagtcaag
gctgtgaaccgattagggccaggagattgctgcgaaccaactgagccaattctcattcag
tcggacgaagctgcaccaaccgtacaacttgacgcgaccgttaccgatggtgtttctgtc
aaagctggttccatgatcgagattcctgccatcgttgctgggcgacctttcccaacagcc
cgatggagcaggaacgaagttattcttctgcccgaccaacgagtcactgtcgatcttgtt
gataatgtttctactttgcgtgttcttatggcaaaacgcgaggattctggtgattacact
gttttggctcaaaaccaacacggcaaagcgtccattaattgttcagtacaagtgatggat
aagccaggaaaaccggcgtcagttgacattgaggacatcaccaagaactcgtgcagtgtt
gtatggacaccacctaccgacgatggtggcactggtattattcgatacactgttgaaaaa
cgtgaaaccaccagacacgtatggacaaagctgtgtggtacagtgaaggcagatgaacga
cgttttgaagtgaccaaactaattgaaggaagaacttatgaattccaggtgactgctgaa
aaccaaatcgggtttggtgagccacagtgcagcacatcggtggtcgcgaaatatccattt
ggaccacctgttgctcctgacgcaccagagtgtaggagtgttactcgggatggcatgacc
gtaacttggacccaacctcctgtaagggatgctggtgcagtgactggttactaccttgaa
atgtgtgtgaaaggaagtcaaaactggatgaagttacaaaagaagccgcttgacgccgac
actttgtcgtacagagtaacagggttaaccaaggacaagacttacgttttcagagtatct
gctgaaaacttggcaggatgtggaccagcaagcgtaccaagtgatggtacattagcacga
gatccaaccaaaccaccgagcaaaccaggaaaaccaaatgttatggagattaccaagagc
acatgtcgtctccgctggcgcaaacctgaaactgatggcggtgaaccgatttcgaattat
atcattcaattgaagaaacgcgaagttggcgttgaaacttgggatgaagacttcgtgcct
tgggagttggatgttcctgatgttgaacacgttgttgtggacttggttcccaacacatat
gaatacgctttcaggattgtggcagctaacagcgccggtaattctgaacctggtgaagaa
tccgagaccgtgatctgcaagcctatactgaagacaccaagcgcaccacgggatctgaaa
tctgccggtactacaaagaatagcatcacccttcaatgggtaagacccgatgatgatggt
ggtagccgaatcaagggttacattcttgaaaagcgtgaacttagacgacagacatggcag
ccattggaaaaggaattggaaaacgagacttatgtcattgaagaccttaaagaaggaggt
tcgtacgagtttagagttgctgcgtttaacgagattggaacgagtggttggacacaatcg
gagcccattgctgctgttagcatgtttagtgtaccagagcaaccacgatcgcttaagatc
gacgagttgttcagataccatgtcgtgctcagctggaaagaaccagttttcgatggcggt
gcaccggttgtgagttactccgtagaaaagcgagagaagctttcgcaacgatgggtaaat
gttggcaaaacagaaaaggcagattgcacattcaaggtacgagatgtaaaggaaggaact
gaatgccagttccgtgtgatggctgaaaatgaagctgggcttggcaaaccaagtgaacca
actgagataatcacaattcaagaccctaaatctccaccatctgagccattagacttgaaa
ttggtcaccacaagtcctacttccattacccttgcatggacactacctgccctgaatggt
ggactcgatgttacaggttacttcatcgaacgttgtcttgaaggtggcgaagattgggtc
cgttgcaacgcggccccatttaaaacaacacagggcgaggttactggattacgtgaagaa
cgatcttacattttccgtgcctttgccttgaacgaggctggcgtaagcgaaccaagcaaa
ccaaccgacagcattgtagctaaagaaccggacgcggcaccgaccatgaaaatgctgcaa
aacgacatcgtgcttgttgctggtgagaaactgcgtgtacgagttccaattactggatca
ccgaagccaagtataacatggacacgtgacgataaagcaatgaaagaatatgtaaaggtt
tcactggacgacaactgttcagttcttttcattcccgctgccgttcgtgaagacggtggc
cggtacactctaaccttggaaaacaagatagaaacaataaccggatggtgccacgtcaca
gtacttgatcgacctggtattccgatcgactttgcagccactgaaattaccaaatcaact
tgccaacttacatggaaagagccacaggatgacggcggttccgagatcctgttttattcc
gtagacagacgagaagctggcaggaggacatggacaccagtcgttgctgaagtgcgcaaa
acaacctggcaagtgacagagcttcttcataggaatgaatacaacttccgagttacagct
cacaacaaggtcggcgctggtaaaccagtagaattggcaagtgatattatggctgtggat
cctttgtctgctccttcagcaccagaagagcttacttactcagaaccaagagcaaagtca
gttattctatcttggaagcggccaaccaacgatggtggttgcaccattactggatatatt
gttgaaatgaaagcaagtgatgaggaaagatggaacgttgttattcgggatcatgattct
acctctgtaaccgtcttgggccaaatcgagggcaaagaatatgcctaccgagttgctgga
gtaaacaggatcgggattggacaacgaagtgaaacaccagaccttatcatggctaaggat
ccgcttgcagttccaaccatagaagttagtcaaatactaagaaaggggttggaaacaaga
gccggtaaagaaatgcggatagaggcaacttacacgggtgtaccaagaccgatgatcagc
tgggttcagcaagacaaggtcgacacacccgttgaggaagataaggcaagatcgacatcg
atgattgcatttgatggaaccacaaaatacagagtaccagacgctaaacgatcggacaag
ggaacttatttgattaccgccgaaaatgaccaaggaaaagcgactgcttcagttgttgta
aacgtgttggatgtaccatcgccatgcaagggcccgtggtcgtttgaagacggaacgaat
gaagcagttactctgcgatggaaggtacctgaggacgatggtggttcagatatcatcaat
tatgtcatggagatgaaagaatcgaacaagaaggtttggacgaacttgtcgacaactctt
cagtcaacaaaataccgagcaacaaaactcgtagaaaacaaagaatatatcttccgtgtt
tgcgctgaaaataagatgggacgaagtccttggcttgaagctgcaccatacgttgctaag
ttgccatttgatccaccagcagcaccggagaagccacttgttgtggatgtgactcgaaag
tcaatgaccgtcaagtgggttgaaccgtacgatggtggcagcacaatcttgggatattgt
cttgagaagaaagatacttcagcatcgagatggtcgcgagcatcaagggaactcatccga
gccgtggagtttgtagtcagcactggcttgactgaaggacttacctaccaattccgagtt
tcagctgaaaacgaagccggaccaagtaaattcagtcagccgagcgactacaatgtgtgc
gaggatccagtctttgctccatctgctccaagaaagccgagagtagtcgacactacaagc
agttccattacactaacttgggatcgaccagaaggcgacggtggcgatgcaaaacttaag
tacattgttgagcaacggttggccgatggatcatggagtcgatgtaatgacaaggacttg
gattcaacaactttcacagttgagaatcttcaagacggacaattgtattctttccgaatc
aaatcaataaaccgaggtggtgagagcagccctgccacacttccagaagtagcagctcga
gatatgattgatcttcctcatattgagttggacgacagtgtggttgctggaatcacagtt
gtatcgggtaaaaagtttgttattcccgccaaggttactggaagaccataccccgaaata
acttggaccaaaaatggcgaagatgttactgatcgggttgatgtcaaaaagaccgaagat
ggttcacaagtgaccgtcaaacgaagcattcgatcagattggggagagtacaagatttct
gcaaagaattccagcggagccaagagtgcaacttgtctcgtcgttgttcaagatgcacct
ggtgccataaaggagctcaagcacggtgcagtgagcagaaactgcatcactctgaagtgg
catgctccagaagataacggaggcttacccgttaagaaatatcacttggaaaagcgagac
atgtcaatgagagcatggctcagcgttggcagcactgacaagttttcaatggatgttaca
aacgtgctggaaggagctacttattccttccgcatctgcgccgaaaatgacttgggtaaa
ggcccgttgacagaatcgattcctgtgctttgtgccgaaccattggttgtacctggtcga
cctgaaaacctcaggatcgaagaaaagaaagacacgtctattgcccttcactgggtcaca
ccacgatttgatggtggcagcaaaatcaaaggatatatcattgaaagaaaggctgagggt
gaagaggaatatattggttgcaacaccggactcatcgaagaaacgaagtttgttgttaag
gaattggaaaccggcaagaagtacgttcttcgtgtgaaagcaatcaataacattggagag
agccaacctgccctgacacaacttactgaagcaaaggaaccggaagccgaacctgagatc
agtttggatgttggaatcaaaggatcaatgcaagttcgtgcaggagccagcattcatctt
ccagcaactgttcttggagttcctgctccagaaattgtgtggacgaagggagaagatgaa
aaacttgttgatggcgaccacatgaaaatcatcaatcaaaacaaaacctcgtcaatgtat
attgagaaatcagttcgatctgacgatggtgtttacatggttactgccacgaattctctc
ggtagcaagactgctagggttacagttttggtgcaagatgtcccagcggcacctctgaac
tttaaaccgacaaaggtaactgctgaaagccttctactgacttgggaagcaacgccggat
aatggcggcgctgacttgatgaattatgtgatcgagaagcgcgagggaaagaacaaaaac
tggacccagatgagcacaactgtgatcgacacgaagttccgagttgcaaaactgaccgaa
ggtactcagtatcagttccgagtcgccggcgaaaataagtttggtgttggacactatgct
gagagcgaaccagttattgctaagaacccatacgatcttccaggaccaccatacaaacca
actgttagcgaaaccaccaagacaagcatgcttgtatcatgggaaccaccgtcatgcgat
ggaggtgcagagattgaaggatattggcttgaaatgaaggacagtgattctccacgatgg
aagaaagtcagtcgagctcctatcacgaaaccaccgctggtaggttgctcctacaaggtt
ctgcagctcgttgagggcttagaatacaaattcagagcatgcgcagtcaacaaggccgga
cttggacctgtcagtgaagaatccgaacctgtaaaagccgaagatcccacctttgttcct
agttcgccagagaaaccagaggttacagatattactgcaactacattgtcactaagttgg
tgcgagccagcaaacaacggtggaacaccaatccttggctacattgttgaataccaggac
caagtgaaatgcgaatggacgaagctgcttatcgatgagaaggagcttatttctgcaact
acagcaaccgctccaaacttaacgacaagacttcgataccaattccgtgtttctgctgta
aacaaagttggtcaaagtgaaccaagcacagcaactgcatttattgaaattaaagatcaa
atcgagccagcctcgataacgttggatgttggaattcaaaacgttttggaagtacgagcc
ggtgcttcaataaaactgtttgctaaaattcaagccaggccagttcctgagattcgttgg
gagaaagacgacaaactaccgctaccgggaaccgctgttgttaaaaacactgatgactct
tccgaagttaccattcccaattgcggccgagataacagtggtcgatacactgtgcttgcg
aagaatactggaggtctacgcactgcttcatgcaaagtgcttgtcaaagacacccctggg
gcaccggaaccactggtggtttctaatgtcaccaagagggctgctaaactcgcgtggaaa
agcccaagcaacgatggaggatcaaagattcaaacctacatcgttgagaagcgaagagcc
gatggtcgaggatgggtgaagcttgattcttcagtgtcagccacgcagttcaatgttctg
gatcttcttgaaggctttgaatactttttccgcgtctgtgcagtcaatgcaattggacaa
ggagtgtacgctgagacatccgagccaatcctagcgagagacccaacttcggtttcagac
cctccatcgcacttacgagtgactggcgttaccggaacaagcgtttcattgaaatggaac
gttccacagttccttggaaacttaccgcttaaaacttacatcgttgaacgacttctacgc
gaagaaactgtgcagaccagtacagtggtaattgagcaaactacacaacaaaccacggaa
ggcactgctatagttcaaactcaaacatcaagaagccaatcaaagggcgataactggaca
agctgcaacccggccaagttgaccgaaactagctacaccgtgacgaatctcagcgatact
gagaagtacaccttccgagtgcttgctgaaaatgaggttggcgtgagcagaccatccaac
agcgtgggcccggtaacatgcaaggacgaccttgtgtatccgaccattgaaacggttgag
ttcaaggagcttgaagctggagcatctattgatctctttgctaagtttactggaaaacca
aagcctgagattacatggaatctacaagaaaaagaaattaaaaacacggacagggtttct
gtgacaaccgatgacaactctacaaacgttataatttccaaatctattcgatcggatact
ggtgtgtaccaagttgtcgcgaaaaatacagctggaacctgcactaagaatattaaagtc
aacattcttggcaaacccacagcacctgagctgccattcacctttagttcggttactgct
tccgagattacagtgtcttggatgccaccaaaggacgatggtggaagcaggattacaaac
tacaccgttgaaaggcaagaagaggatcgagactactggcattcggttgctgagtgcaaa
gacttgagcgcgactgcaacgtcgcttaaaaagggaaagaactacttattcagagtcaag
gctaataacaaatacggagccagcacttggactgtaagcgacactccatgcgaagcaaag
aaccaatacgagtgcgcatctgcaccaggacaaccacaagtgactggtgtatcaagagat
gccatgaccgtattctggaacgtacctgaagacgatggtggtgctattatttcaaactac
attctggagaaacgatctcgcaccaagaagaagtggtccaaagctaccactgatgaaatt
ggtggtaatcaataccgagttcgagggctaagagaaggccacgagtacatgttccgagtt
gctgcagtgaacgctgcaggacagagcgagttttctcaaccaagtgacttaattttagca
agcgctgcaatttctccgcctggaccaccattcccaagcgtcaaagacacaacgaaaaat
gctgtatcgctcgcatggaaagttccagatagcgatggtggctctaaggtcaagggatac
cacgttgagatgcgggtggctgattccgaggattgggtaaaggccacaaaacatgatcag
cgctcctgtgagtttgttgtgccggatctcgtcgaaggtaaacaatactatttccgagtt
gtcgcgttaaatgctgctggacaaggagagcctggctacattgccgaagccgtaacaatt
caggaaaaacaagatcttccagaaattactctcgatgcgtctttgaaagacaagattgtt
gtaaaggctggcggagttattaaaattccgttgtacgttagtggcagaccacaaccgact
gtagcgtgggagaaagatggaaaagatcttccagaagaagccagagtaggagaagcagga
ggtagccgagatctcgtcatccgaaactgtcagagacaacactctggaaaatacactgtc
atcgcaagcaacgctgcaggagaaaagcgtttggatgttgaggttcttgttcaggacgta
ccaggagtctgtggaggtcctattgaaccaaccaatgtcacacgtgacacagttggattt
tcgtggtctcctccaaaggacgatggcgggtgtactattacaaactatgtgcttgagaaa
cgggaatcgtcacgacgatcatggactagagtttcaatgactgtgacacgaacgtctgct
gtcgtgcaaggtcttattgaaggcgagtcctacatgttcagggtatcggccgaaaacatt
ctcggagttggtccaggtattgagacatcagtacctattaccgccagggatccagtttcg
gagcccggcaggccagaggaacttcgtgtcactgacgtaactcgtagcaccgtgagcctt
gcatggaagccaccaaagtccgacggtggtttgccgatctcagaatatctcgttgagaaa
cggttggttggacaagaacgacaatcaccagctacggaaaagatggtacgggacactgag
gttactctggaaggatttaatgaaggcgacaactacgagttcagagtaattgcaaagaac
gatcgaggtaccggccctccttcattcccaacaaaacctgttgtatgtcgagacatcatt
gaaccaccaactctgaaaattgatgcaagagagaaagttattgttagggttgatgagcct
taccgtatcttggctaagatttcaggacgaccggtacctactgttacatgggaacaagat
ggcaacacggttcaaaccgacgcaagattccaaatcaagacaactccaactacaagcgcc
cttgaagtacacaaaggaatgcgaaaagatagtgggctttacaaagttacagttcaaaat
gaaggtggccaacgagatgttaaggttattctagcagttgtagataaacctacaccacca
cgtgaacttgaggttaaagaggttacgcgtgaacatgtgatgttatcatggagaacacct
gaagatgatggcggctctgaactcctcaattacgttattgagaagcgggacatctctcgc
atgatgtggactactgtcaactctacgagcctaaaaacagatttccgcgttaacaagtta
acggaaggttcagagtacgtgttccgagtcatggcagagaacgaccaaggttgttctatt
ccagctgagacccaaggcgttgtagtgaaggaccgataccgtgttccagatgcacccgat
gctctaaccatcaaggaggtacgaaaggaatcagccggtctgtcctggagcaagccatac
gacggtggaaaagccatcttcaattacgttgttgaaaagcgtgaactgaagagcgagcga
tgggttcgtgtcactaaggaactgattaacgaaactagatacacagttaccggactttac
gaaggcaatgaatacgaattcagagtagctgctgaaaacagcgtcggaattggtgcaaaa
tgtcttccatctaagcaaatcaaggctgagaacccagtatctccacctggaccagcagtc
aacccacacgttaagggtatttcgaagaacactgtcactgttacttggcaaaagcctcgt
catgacggcggtgcaccagtgcttgggtatattgtggaaacacaaaaggctggtagcgaa
gcttggaagatttggtgcacgcaagaaacacaaaagacgacaagttacattattcctgat
ctgaccgaaaactacgaatacagagttcgagttacagctgtaaacaaagctggtctcagt
gagcctgttatggtcaaaggaactgttgtcgtgaaggagagacaagaagcgccagagatc
gaagttcaagcaagcatgtctcgagagcaaatcatcaaatcaggattgcctttgagtttg
agcgccatcgttcgtggaaatccgttcccaactattacttggagcaagaacgatgaagtg
attccggctacaaatgaacgatttgagcgttccgttaagcatggcattgtcaatatacaa
acggaagcttcagctcgatcggacagtgggcgctattcattaactgttgaaaacggagct
ggaaagaaaactgcatctgtcattgtcaatgttttagacacaccaaacgccgtatcgcac
attcgaatcagtgaaataaggtccgactcgtgctaccttaaatggaaagcaccgtcagac
aacggtggtgcggtcgtctcaagctacaaggttgaacgatacaacgtggaatcccaagtg
tggaagccagtagcaatggcagccaagaagaccagcttgatggtgaagtacctgacagag
ggtcatcactacaagttccgaattgcagcagaaaaccagtttggcctcggtccaaatatc
gactctgacgaaatccttgcgagagacccaattcacacaccaggcccgccaaagaatttg
gaagtatcagacattgataaaaccgcaatcactgtttcatggatgaaaccagacagaaat
ggtggagcagcggtcagtggctacattgttgacttcactgagcttggtaacgaaaaggat
attgatgacaagcgtaaggcaggcatcaatattgacacaaccggtgaagaatggaccaat
ttcaagactgtaacagaaacatcatgcactgtgactgatcttaaagaaggtgtgttgtac
aagctacgagttcgtgccatcaacgaagcaggcgagagccgaccagaccatactgtgccg
gttgccccaagacagaagttgtcgtctccatcgattgaaatcgacgttaagactctggaa
ggtttgactgtaagagcaggaagcacactccgcattcccgcaacgatacacggcgtgccc
gtacctacagtacagtggagcactgctgatggaaacgttgtggtaacagatgaacgcata
acatgcgacactgacaacgtatcaacacttcttactataagaagttctttgagatcagac
acgcaagaatacacgttgacagtgaagaacgatgctggaacaaaatccgcagccgttcac
gtaactgttttggacaaaccagcaatgccaatcggaccgatgaacattctcgaaatgaca
ccagaatacgccatcatttcttggaatccaccgaaggacgacggtggctcaccaataaca
aactatgttgttgaaaagaaagacacttctaaacaaacatggggagttgtgagttcgaag
agcacaagaaacaaatgtaaagtgccgcgtcttatatcaggaaaggaatatctcttccgt
gtcagcgcagaaaacaagcacggagtcagcgatgctcttgaatcgaaaccagaggtagct
aaacacacatttgatgttccggattctccaggcgttccagaagccagcgaaatcacagag
actggatgcaccttgcattggtcggcaccggctagtgatggcggaagcacaattcttggt
tacactgtcgaaagactggacaaggagagtgggcgatgggctaaagtcacacatgatcct
ttacttggattcacaatgcgggttaaaggtttatttgaaggaagactatatgccttccgt
gttactgctgagaaccacgctggaatgagcaaaccctctgaacaatctccatttattaaa
gcattgcgacccatgacaaccccgggagctccaatcaaccccaaggttgctgatcacgat
tgttcgtcagcaacattgacttggaacaaaccacttaaagatggcggtagtgctatcacc
ggatattacgttgagtgccaacgtatggatataaagcagtcggctgatgaccagtcggcc
aaggaatgggcacgaatcaatactaaactgattgaaaaatgcgaattccgcgcaccaggc
ttgaaagaaaacattgagtacaagttccgagttcttgcagtgaatgaggttggcgaaggc
gagcctcgcgacatcccagaatctacaatcattaaggatgttttagaagagccagaaatt
gatctcgatgcgttcatgatgtccacagtcacctacagagttggacaaactgtgaagttg
accgctcgaattaaaggacgtcccgtaccagaggtagagtggctcaaggatggccatgct
gttgatttgaacagatacaatgttcaacgtacagcaattggaacagaacttaccggtaaa
gaatcggagcgttccgacagtggtgtttacactctgaaagccaagaactcagctggcgaa
aaatcagtaaagattaatgtcaatgttcttgacaagccaggaatgtgccgtaatctaaaa
accagttacatcaccaagaactcgtgtgtactgtcttgggacaacccagaagataatggc
ggcacagacatcataaactttatccttgaaatcaaagagccgactcttcccggattctca
tccttcggatggacgattgtcagctctgaaggaacaaagaaaatgatcaaatgcaccatc
gtggagaaccatgagtatttcttccgagtatccgcagaaaacaagtgtggtgttggtcca
agcctagaactgaaatctcctattactgcaacggatcctgcacaggtcccacaatcacca
agagacattaaagtaatcacaaccacaaagaacaccgttgaattgggttggagcaagccg
gattggaacggtggaagccccattatctcataccaaatagttgtgatgaaacggggtaca
aaagattggaaagaagtggaaacaaacaagaatgaatgccaatggaaacttaccgacctt
gaagaagacgcgcaatacagatttggagtgatggcacgaaacaaggctggtgtaagccaa
gtgtgtgtcacaaaagattacgtgacggtttgtgaagatgtcattatgccaaccgtcaag
attctgacaacacaaactaagggcgagattcttgtacgcgctggaactgatttgattatc
cgtgcctcaatggctggccgacccgcaccagatgcagtgtggaaattaggtgatgttgat
cttttcaaagttgcccgtaccagcatcaaatctaccgaagatgaaacacgtcttactatt
tcgaacgcgacccgtgccgactgcggccactacgttgtttcggctagtaataggattgga
agtgacagtgcaagcgcccaagttaatgtccttgacaaaccaggaccttgcgttggcccg
attaagatcatttcactgaacaaagaccgttgtacagttgcatgggaaccaccgacggat
aatggcggttctgaaattaccaactaccagcttgaaaagtgcgagacgagaaggatggtt
tggtcagtggtcactgcctccgtaacagcatgtgcatacccagtgccacgactccttgag
ggcaacgagtacattttccgagtgaaggcagaaaacaagatgggtgtcagccaagcaatt
gaatcctcacccgttgttgcgaagagtccgtatgacaaaccaggagcaccagacgttcct
gaaataactaagatcggaaatggaacagctactgtagcatggaaagcacctgaaaaggat
ggcggaagagacatctccggctactatcttgaaaagcgtgagaagaagggtgtgcgatgg
tcgccttgcaataccaagtccaccatggaacgccgccttaatgtggttggtttatctaat
ggatacgactaccaattccgagttgcagccgaaaacgagatgggcgtcggtcaaccaagc
gaaccaagcaagatggtcacaataaaagaacctaccgaagtacctggaccaccatctaat
ccaaaggtcgttgataccacaaagacctccgtcacactgaagtgggctgcacctgcttac
gacggtggtacacgaatccttggatacgtggttgaatccagtgtcgagggtcttgacgac
tggagaaaatgcaacgttggtgtgggcacacctaagactacggagtttgttgtaaccgga
ttgcgtcaagaacaaacttacgttttccgagttgctgccgtcaacgaagtcgggcaagga
aaatatgaaagcgttcctggtgcagtaaaaccagttgagattttggaagaacccgaaatt
gatctggatgcagatatgcgcaaaaatattgaaattaaggctgggtcaactcttagactc
ttagccaacatcagaggacgtcctaagcccagtgttaagtggaccaagcaaggagctact
ttatcgcgtcgtgcagatgttgatgttacagatttgaagacgacattggtagtacctgac
agcactcgtgaagataccggcaaatacaccttaacagcatcaaacgcaaagggctcaaaa
tccatcaatatcaacgtgaaagtattggatacacctggaccagtcagcaacattattgtt
aaagacatcaaggcaacatcggctcaaatatcttggacaccacctgatctggatggcggc
tccgaaatcatcaactatgttgttgaacttaaggagtccgacaagaagacgtggtccgta
gcaacaactgaatgcccaaagacagcattccgtgttaccaagctcgttgaaggcaaagac
tactacttcaggatcaaagccgaaaacaaatacggagttggcgttcctgctgaaatcccg
aaacctgtaagagcacgtcatccaataactgaaccaggtccagtcaataagttgaaaata
actgatgttacaaaatcaactgttaccttgacttgggttcaaccagaccataccggagga
agcaagatcactggttatgttattgagcatcaaggagaaggatcaaccaactggtcagag
tacagaactgtatctgacacgacagtgaccgtggtaaacttgtcaagtaagaaatacaag
ttccaggttaaggcaagaaatgaagaactttcaggtcctccgagagagacagatgttgtg
gatgtaaaggaaccagctgaagctccaaaaattacgattccaaaggaagtcaaggttcga
tcaggcaagaaactggtcgtggaagctggaattaccggcaaacctcatcccgtaacttac
tggatgcgaaagggtgttgagttggtggaaagtgagaagttattgatacagaaaacatca
tcgaccgtatcactcactattccgaaggccgaacgacatcattctgatgaatacattata
agagccgagaacgctcatggaaagaaacaaggaaccgtcaaagttgaggttctggataga
ccagcacctccaaccggacctgttgaattcaaagacatcaacatcgacactgttactcta
ctctggagcgcccccgaagacgatggaggttgcccaatcacaaattatattgtggaacaa
tcggaggcagatcaccctggtttcaaagtgatcagcagcaccgtatcaagaacaacatta
agagtcggaaaactaaacaaggattccgaatacgtgttccgaatcaaggctgaaaacaaa
tgtggagtaagtgatgtactttcctctgctatggttaaggcaacatatccattcacggta
ccaggagttccatgtaatctggacgtggttaagatcggaaaagaatccgtgactctatca
tgggacgttccagaagtcgatggtggcaatccagtgcgcggttacaacattgagaagaaa
gagctaaacagtcttttgtggacacctgtaaacaaatctcttgtaaaacgacgtgaagtc
gtagataacactttgcttgagggtattgagtatcagttccgagttcaagcatgcaatact
gctggagctggcgctttctgcaagccgaccgaaccacaagttgcaagagatcaatgtgat
gcaccaggcaagcctgatgtcattgatgtcactgacacaactgttgagctcggatggaca
gctcctcgaagcgatggcggatcgaagattgcaggatacatcattgaaaagcaaaagcta
ccaagtgaaaaatgggtgcgccatattacaaccagagggccacaaactgctgtggttttg
gaaaacctggacgaaggggaaaggtattgtttccgcatcattgccaaaacggcagtcgtt
gtgtcgaagccatcggaaccaacagatgccacccttgtgcgacaagccattgcagcacct
ggcattgtactcgatgcatcttgcaaagatttgctcgaagtaagagcagggcaagatatt
gtaatcgaagctacaattgccggtaagccaaaaccaaccgctgtgtggaaccgtgctggt
ggagaacaaatcaaacctacaagcgatgggtcgattgtggtcgagaatgtgctcaaccag
tccaggcttataattcgaagttgcaagcgatcagatgctggcagctacgtgttaacttta
gaaaacacaagcggatctacttcagccactgcgaaagttcgagttcttgacgttcctgga
atgccagaaggaccagccaagttttccaacgttcttgcagatcgacttaagcttacatgg
tctccaccccttgaggatggtggggcagctatcactaactacgtcgttgaacgccgtgaa
acatctcgtccaacttgggcaatggtcagtggcagtgcacagagcaccgaattgagcgtg
cagaagctcatacaaaatcacgaatacgagttcaggatttctgcagagaataaatatgga
atcgggcaagctttggttactcagccagttgttgcaaagaatccattcactgtaccatct
gctgccgaaccaccgattgtgtctaatgcaacgaaagaaggcatgactgtcgcatggaag
tcaccatctgatgacggtggcaaaccaatcagtggttactacctggaaaagcgtgagact
aaggctgtacagtgggctaaagtgaaccgacgaccagtttcggatcgttccatcaaagta
actggacttattgaatgtgcagagtatgaattccgggtagctgcagaaaatgcggcaggc
attggagcatttagtgcaccatcaactccagcaaccgccgacgatcctaagtacccacca
ggtcctccagctttccctaaagtcatcgacacaactcgaagcactgtcgaactttcttgg
ggcaagccagcttatgacggagattcaccgatcacaggttatgttgtggaaatggcaaac
ccggaaagtccagacaagttcgaccgcgtcgcaaccacacatatcaccaagtacacaatg
accagcttatcagatggacgagaataccgattcaggatcaaggcggtaaacactattggt
gagtcggaagccagcgaggtacctggaagcgttgctcctaaggatattttggaacctcca
gcaattgatctggatgtttcaatgatgaaagcgttggtcatccgagctggaaacacaatt
cgcttgtactgtggactgaaaggacgtcctgcaccacgtgcgagctgggccaagcttgga
gatgagcttacaatgaacagagttgaagtaaaaacatcagactgggacacgacattgatg
gttccaaactgcaatagggacgactctggaaagtacatcctgaacgttgaaaacaccagc
ggtactaaatctgcaaccgttattgttcgcgttcaagacacaccgggggcacctggacca
attgtgttcaaagaagtgactttggaatctgtttctatggcatgggaagctccaaacaac
gatggcggttctgttatcacaggatatgtcgtggagaaacgagagtccacacgaaaagct
tgggcgacagtcactgctcagtgctcgcgaacgtcatggactattaacaagttggaagct
ggaaagagctatttctttagggtcatggctgaaaacgagtacggtgttggtgttccatac
gagactcctgaaccagtaaaggttacacaagaacctggacctgttcaacgattagaggtt
gttgagacgaccaagtcaagtgccactcttaactggttgaagccaaaccacgatggagga
agtcggttgattggatacatcgttgaaatagcgccaaaggataccgatgactgggacgtt
gctgctgaagatgtgaaagtactcagctacaagattaccggtctaagcgacggcaaggaa
tattctattcgagtatctgctaaaaaccaagcaggaactgggcaaccaagagaaagaaac
cttgttgccagggatgagacaactcttccatcctttgatttgactgaactaccaaacatg
actttcttcgcacgagagggaacgtcagccaagttgaagcttccagtacaaggcgctcca
aaacctgagattaaatggtcaaaggacgacgaagacttgaaacaggacaccagggtttcc
gttgaagacacacagatatcaactgttgtcgtcatcaaggaagtgagaaaagtggacgcg
ggaaaatactcagtggccgccactaacgttgttgggaagaagaccgccatcattaaggtt
gttgtggttggaaaaccaggagttcctcatggcccgcttcaaatcagcgacttaactgct
gaacatgcaacgctaacttggaatgcgcctaaagacactggaggttcggaaatcaccaac
tacattgttgagaagcgtgatatcgcgactggtacatggtcgcttgtgacgtcatcaatc
gcccgaccgacatgccgtgcatccggtttgattggtggcaacgaatacaccttccgagta
atggcagagaaccgattcggtgtcagttcaccattgctatccgagaccgttgttgcaaaa
tacccattcaatgtaccttacgctccagccgcaccagaagtaacgttatgtaagcgcgac
tcaatgatggtacagtggaaaccaccaagaaaggatggtggttctccagttactggatac
attgtagaaatcaaggaacgcaactctattctgtggaagaacttgtgcaaaactcacaca
acagaatgtcgagccttgaaccttaacgaagggttggagtatcagttccgtgtatatgca
ttgaaccaagctggacaatccgaaccttctgacgcatctgctgttaaatatgcccttgat
cctgttgggccaccatgtcgaccaatcgtttacgattcaaccaacgagagtatttctgtt
cgttgggaagtaccaaagttcgatggcgggcaccgcattgtaggttacgacgttgagcgt
ttgaatctgcctggaaagaactgggttcgatgcaatgttggaaatatatcagcaacaaat
ttcgaagttacaaatcttacaccgggcagtagatacgacttccgtgtacgcgctaaaaat
tccgcgggatccgtttctgaaccgtcagagacaacaggagccaccgtatgcaaagaggaa
tatgaacctgcgagtgtctcactggatttggctctaatggacggtttagttgttcgtgct
ggtgaagacgtacagcttcacggaataactgaaggcaaaccgctaccaaaagtaacttgg
tcattaaacgagaaggagctcagagatactgatgacatcaagatagagagatcaattgcc
caagcaacgctcacaattaagaatatcagattggtcaatggtggaaattacacagtcacc
gcttcaaaccattatggatcaaagtcagcaacttgtcgcgtacaagtacttgacaaacct
ggagccgttaccgcacctgttaagatcaccggaatgactgcagccaaatgcaagctttcc
tggggagcgccacaaaacaacggtggaagcacaatcactaattacgttgtggaaaagaga
gaaaccagccgtctgttatggacttcggttggagacgctggtatgcattgcgaaatgaac
tgccagaagctcatcacaggcaacgagtatatcttccgagtatctgctcagaataaatac
ggagttggcccgcccaccgaatcgcaagcagttgtatgcaaaaatccattcgatgcacca
ggcgctcctggcaagccaaccgttactaagtctacaaagaccaccatgactgtgacctgg
gacagaccagagtcggacggcggtagtgagattcttggatattatttggaacgccatcac
aagaaaggattgaagtggattagatgcaaccacgaaccgattcgggaaaacagacacagg
gtaactggactcacagaagattatgagtacgaatacagagtatccgctgaaaacaaggga
ggcgttggaccattgagtgatgtatcttgtaccacaatagccagggatcccatatacgaa
ccaggtgtaccgggcgccccacgagtcactgataccacgaaaacttcgatcagcttggct
tggtccaaaccaacacatgacggtggagctccagtgtccggttacgtggtcgagatggct
aaggaagatggcgacgatttcgaagttgtcagtggagctcaacccattggatcgccagag
tttgtggtcactagcttgatgtccgacttaaagtacaagttccgtgtacgagccgttaac
gaagccggcaaatcggagccaagttcggaaaccgaggccactaacccggttgagatcatt
gagccgccagcttatgaattagacgctgatatgaaacaagcactcacagtaagatccgga
ggttctattcgattattcgtgactattaaaggacgaccaacaccgactgccacttggact
aaggagggcggtttggacacagatagaacagacattgatacaacttcgtcatacagcctt
cttgtggtaaataattgcaaccgacacgacgctggaaaatacgagttggtgatcgaaaac
acagctggttcaaaggttgttgctgtgaatgttaaggttttggattcaccagggccagta
cagaatcttggagttcaagatgtgacacgaagcactgcctttataatgtgggatacaccc
aaatctgatggcggcgcagttgtctcaaactacatcgttgagaggcgcttgtcgacaaga
aaagcgtggaccacggtatcgactgaagtaaaccgcgagtcctacaaagtcacaggactc
caagaaggcgagcaatacttcttccgtgtgcttgctgagaacaaatacggaattggcgag
cctgctgagacccgcgaggtcgctagaacagcagaggttccaggagctcccaaatcattg
gacttgaccgacatcagcaaaacgactgcgtccttggtgtggaccaagccagactctgat
ggaggaagtcctatcacttcatacttgcttgagcttcaacgtgttggaatggaaacctgg
attactaaatctactacaagcgcaatgaaggcaaccattaacgatttgaacgaaggagcc
gaatacaatttccgagttcgagctaaaaattcgatcggtgctggcgaacctacccagacg
ttgcattcagttgttgcgaaggacgatattatcaaaccaggagttgaccttagagatcta
tacatgggcacaataacagctaaagctgggaccaatgtccgcattaaagttccattgatc
ggcaaaccgttacctactgctcagtggaaacgaaacgaagaaaccgtacgtgagacacaa
cgtgtcaacaccgacttgggcgatggttgcacaatattaaacatcaaggattgtcaacgt
actgacgctggaacatacgacatagttgtcaaaaatgctgctggcagtaaaacagtgccg
cttaagctgaccgtgtttgatcgtccaagcatgccacgaggcccgatcgagtttaccaac
gtaacggctgatgcactaaatatgtcttggcaagtacccgagcaagatggtggcgcacaa
atcaacaactatgtcgtcatgagtcgcgaaaaagaaagtgataaatggatagaaatcgct
ggatccgtggcgagaacttcgcttaaggtgggtcgcctcactcgggatcaggaatatatt
ttcagagtgtttgctgagaatagatttggtcgatccgaaccgttggattcgaaagcaatc
cttgtagaatatccattcaaacgacccggtatgcctggtcaacctgaagtggcgaaatgc
acacgagatacggtgacgctgacttgggatgcgcctacaagtgacggtggtgacaagata
ttcgcctaccatgtcgaaaagaaagacaggaacgccattttgtggacaccagcaaccaga
gctcctgctaaagacacttcgctcaagatcactgctttgaccgagaatttggaataccaa
tttcgagtttgcgcggagaatttggcaggtgttggaaagttcagtcgagcatctgagtca
aacatatgcagagacagcgttgacaagccaggccgtccaaatattcttgaagttggacgc
aattccgtgtctttggaatgggctaagccagaatacgatggtggtgccaagattactgga
tacacaattgaaaggcgtgaactaccagatggccgatggttgaaatgtaacttcagcaat
gtgatcgacacgcagttcaatgttaccggacttacagaagacaaagattatattttccga
atcttcgcgaagaacgcggccggtgctgtttctgaggcatcagatttatctgaagcgata
acttgcaaggatgaaatctcaccaccacgtgtagaatttgacgcaaaattgcgtgatgtt
ctcactgtgaaagcaggcgacaacgtgaagcttgaagccaagatttctggcaaaccgttc
ccatcagtccgatggagcaaggctggcgagccacttgaagatagcaacttgctcaacatt
atcaacgcagattccaccagtgtggttcacatacgggactgcagacgtacagattctggc
caatacactatcgacctaaagaacatagctggcagcaggagcttgacggttagcttaaag
gttcttgacagacctggacctccagaaaacgtcacggttgctgacgtcacttcaagtcgg
gcaaagatcacgtggtctgcaccacgtgacgacggtggtgctcacgtgacacactacgtc
attgaaaaacgtgaaaccagccgcttagcatggacgcttgtatcaaaccaggccgaagga
accagcttccgagtttcaaaccttttggaacacaatgaatacatcttccgagttatgggc
gtaaacaagtacggacaaggtgaagcagccgagtctcaaccgctgaaggccgagaaccca
ttcaccttacctggaaagccttcccaacccgaagtgtgcaatgtaaccagggattcatgt
gtgctgacttggactagacctatcaccgatggtggatcggaaatcaccaactacattctc
gagaagagagaaaggagaggaactcgctgggttcgtgcaacaaggaaaaacataactgaa
tgtcgtttccgactgacgggtcttcctgagaattcagaaattgagttccgagttgcagct
gagaatgcggcaggcactggtgaaccatctgatgctagcagttatacaactattgtggat
ccaatatatccaccgggaccaccctcgaatccgaaaaccaccgaaactacgcgaaagagt
gcgactgtttcgtggggcaaaccaatgtatgacggtggaagtgaaatcacaggttacgca
gttcagtatgctgaggtgaagggcgaagtcgagattgaagaggacgcttggatcaaatgt
cccctcccagcccgttattcacttacagagtacaccgtatgcgacttggttgaaaaccga
gagtatcgccttcgtattgctgctgttaacaacgctggggttggagagtttgctttggtc
gctggaaaggtagttgctaaagatatcctgatggctcccgatgttgaaattgacgccagt
ttgcgacaagcactgaaggttaaagctggaaattcgattcgactattttcaacttaccga
ggaagtcccgctccaatggttacatggaggaaagacgaaggaaaattacctgatctttgc
cacgttgataccacagattcaactactctgttgttgattgaagattctactagaaatgac
agtggacagtacagcctagccctcgaaaacagcgctggatcaaaaacagtgactgttaat
gtcgtggtgttggatactccatccgcacctacagcgcttgctgcaaaggatgttaccaaa
gagtcagtaactcttacttggtcgccgcctgctaacaatggtgggagcgtggtgcaacat
tacattgttgaaaagaaggaaacaaccaaaaaagcttgggctaccgtcacaatgacttgt
gtcagaaacacattcaaggttttgaaccttaatgaaggcatgagctactatttccgagtt
atggctgagaacgagtacggtattggtgcagcctgtgagacaccgggtgctatcaaggca
tcggaagtaccaagcgcgccaggcaggttggaggttacacaaaccacttctaacagtgtg
tccttggcatggaccaaaccagataccgacggtggaagcaaagttacaggctatcttatc
gagtacagagaagccagtgctgaaagctggaaacaagcggcacaggttaagacaattgcc
ggtacagtaacacgactatcggagggcaaagagtattacttcagagtgaaagcgctcaac
gagaacggcttgggcgaccatcgtgaaatactacaacctgtcgtagtccgtgatgaggtt
gaagcagctgagattgacatgggaggtctttcaaaccttgcattctacgcaaagaaagga
gacgaccttaaagctaaagtcgcccttcgtggaaaacctctaccagttgcagtatggaag
cgagatagcgctgacttgcgacaaaccagtcgtgttaatgtcgatgctttcgaaaattat
tctttacttaccattaaagactgcattgttgatgatgctggtgtttacgagatcattgct
acgaacccgcttgccaaagtgaacgcccaagttcagatcgtaatttacgataaaccaggt
gctcctcaaggacctgttcgattcgacaaagtcacggcagactccattaccttgtcatgg
gaagctccaaaagtcactggcggatgccaaatatcaagttacatcgttgagaagcgtgaa
gccaccagtactgtatggaccatggtatcggctgcatgtgcacgcaacacggtcaaagcc
accaagcttgttgctggaaccgaatacatcttccgcgtcaaagcagaaaatcgattcggt
gttggaccaatgctcacctccgagcctgtaacggcacaacatccttacaagacaccaggt
acaccaactcagccacagatgtgcagagttacgaaagattccgtcactttacgatggagc
gaaccagtcaacgatggtggttcgccgatcactggatatcacatggaacacaaggacagg
aactctatcttatggatgaaaaccaacaaaacgacgatttcggagacggaataccgcgct
agtggtttggaccaaggcctcgagtacgagttccgcgtgtacgctgaaaatgctgctggc
ataagcaaggcaagcaggccatccgagcttgcacattgtcgcgatccgattgacccacca
ggaaagccagaagcattgcaggttggcggacgatatgtaactattgaatggacaaaatca
atgtatgatggtggaagcaagctgattggctacaacgtcgaaaaacgcgaactcccagac
ggtcgatggctcaaggcaaattacggcaacgtttctgagacacatttcaaggtcgacgga
ctttctgaaaaccgaaaatacgagttcagagtgttcgctaagaacgctatcggctcggtg
tctgaaccatccgaaatttcgtcgccaattctttgccgggacgagttggagccaccaagt
ttggaatatgaccagtcgctccgagatacgcaggttgtgcgtgctggagacacggccaag
tttacgatccgagtttacggcaagccttctccatctgtgaggtggtgtagagatggccgg
gacattgaccaatcaccacgtgttaagttcgatcattcaactactcatacaacattaact
attggagatactacaaggaacgacactggacaatatactttacttctttccaacgatgcc
ggtgagcgttctttggcaatccagctcaaagtgcttgatattcccggcccagtaagacac
ttggctgttgaagatatcaccgccaccaaatgtacagtgacatgggatccaccttgcgcc
gatggtggaagcaacatcacaaactacattgtcgaaaaacgccagacgagccgtatcact
tggacacagatcgcttctgatatccaagctagatacattaaagttggacatttgatgaaa
gataacgaatacatattcagagtacgagccgagaacaagtttggtcttggtgatgttacg
gaatcgacacctattgtgacaaagaacccgttcaaggtacctgattcaccaagcaatctt
cagatttcaaatgttaataggaagagtcttattctaacatgggatcgccccactgaagac
ggcggctctgaggttaccaactacgtcgtcgaaaagagagagaagcttggttcgaaatgg
ttccgagtcacttcaagacaaatcgaagaatgccgattgaaaatcactggcttgcaggaa
gggcaggagtacgagttccaagtcatggccgaaaacgctgaaggagtgagtcagccaagt
gccagctctgaatctgtcgtacttcgggatccgatttatccgcctggagagccaagaact
gtgaaagtaactgacacgacaaggagctccataagtttgtcttggtcggcaccgacattc
gacggtggtagtgatatcacaggttatactgttgagatcttgcctgaagatgctgaaacc
gaagactggttggcttgcacatcaagctccggatctatcagcacccagtacactatcact
ggcctgcagggcgagaaattgtacaagattcgcgtacgagcagtgaacgcaggcggatca
agcgaaccggctcagttggccactgctgtgcaacccaaggatgtattgattgagcctgag
attgaagtcgatgccgatgtcggacagtttgtgtccgttcgtgctggaggtaccatccga
ctcttcagtattattagaggccgaccaacaccaactgctaaatggtcgaaacttgacggc
cagataaacgaaatggctcaaattgaaactacggtttattcaacgcttctgctgatcaac
aactgctcaagaagtgatgctggacgatatgtgcttaccctggagaattcatcaggaact
aaaactgtgtcgatcactgttaaagttcttgatacgccaggagctgtaaagaaccttaaa
gttactgaagttactcgggaccatgctgttatatcttgggagatgccagaacttgacggc
ggctccgttgtcagtaactacctgatacagaagcgagagacaacacgcaaggccttccag
gctgtgggaagcaccccacacagaacaagtttcaaaatcaccggacttgttgagggggat
tcatacttcttcagagttttggctgaaaacgagtacggcattggtgtaccatgcgagacc
acacaagcagttaagatctcagaggttccaagcttgccagaacaagtagaaatcagcgat
ataaccaacacatctgcaactctatcttggactaaaccagaacacgacggtggaagtcct
attacagggtatgtggtggagcatatgcagaagggtggcttcgaatcttggaccgtcggt
ggttcgacgaagaacatgaagcttgttgttggaaaacttaacactggaaaagattacgtg
ttccgagttcgtgcccagaacgatgttggcatctcagacggtcgggaaacaaacaccgtg
aatattcgtgagcttctcatcgctcccaacgttgatacaagcaagatatttaacaacact
gtatgcgagaaggtgggaaccaatattcatatcaaggtcccttattcgggaataccgaca
ccaactgcacagttcttgcgaaatggagaaccattgaagcagaccagtagagtcaactct
gttacttccgacggagttgcaaagctcaatatcggagaagtaacccgaaaggatgccggt
gaatacgagcttgttgttaagaattcagtcggtacaaagactgctactctgcgtgttgtc
gtcatggaaaaaccaggaccaccaaccggacccatggagataaaggacgtatctgcagag
agcatcaccgttgcatgggcagcaccagaagaagacggaggaactccagtcacacactac
acacttgagaaactggatagtaatatcgggtggacagaagtatctggattcgtagttcga
acatcgcagaaagtcaccagactcacaactggacaggaatacgtattcagagttaaagca
gcaaacaagtttggtttgagtgatccacttgattctcaacctatcatggcccgtcatcca
ttcaacaaaccaggcgtaccaagtccaccacagatagtgtcggtaaccagtgattctgta
gtaatcagctggcaagagccaaccaacgatggtggttccgccattttaggttaccatgtc
gaacgcaaggacagaaactcaatcatgtggacgaaggcaaacagctacatcgtgcgggat
acaacgttcaaatgcggaaacctttcacaaggtctcagttacgagttcagagtgaccgct
gagaatttggctggcatgggcaaaacaagcaagacatcagacgcagtgatcacacgcgac
ccgatcgaaccaccacgtgacgtgcacgttactagagtcaacagaaccaacatcacatta
caatggcgacgaccagagtacgatggcggcagcaaggttaccggatatatcattgaaaaa
gcggacgtacctaacggtagatggatgaaatgcaactttaacaaagtaatcgatcagacg
tttgaagctgatggtctcatcgaaggaaaaacttacgagtttagagtcatcgcacaaaat
gcagcgggtagcgtcagcaagccgtccgaatccactggatctgtaactgcacgagatgaa
gttgaaccagcaagcgtggatgtcgatgcccaataccgcgacgttgtttgcgttaaggct
ggagaaactttcacacttaaaacacacatcaacggcaaaccagttcctactgtttcgtgg
gagaaagacggaaaggaattcgtttctggacctcgcatcagtattcttacaacagatgta
acatccaacgttactgtaaaagattgtcgcagaaccgacagtggaacttatacaatcaag
gtacacaacgctgcaggtgaacgatctatcggtatcaacgtacgagtgctggatacacca
ggcgtgtgcgagtcggtaacggtgaccggtgttacagccgaaaagtgctctttgtcttgg
cagccaccgaaactaaatggaggcgcaaagatcactggatacacgattgagaagcgtgaa
acatctcgcttggcgtggacagtggtggtttatggcacagaactcacacagcacaaagta
actggcttgatcagaggaaacgaatacatattccgaatcagagcagaaaacaagtttgga
cttggcgatcatgctgaaacagatgcagttgctgctgttgatccgtttgttgctccggat
gctcctggagcaccagaagtatcaaatgttatgaaaaacagctgtactgtgatgtggacg
aggccagaatcggatggcggtgccgaaatagcgggttacatcgttgaaagacgagagaag
aactctgcaagatggcaccgagtcaaccgaagactcgtatccgatcttcgatcaagggtc
actgaactcaaggaaggaagcgaggttgagttcagggtttacgctgaaaatcgtgctgga
gttggtcaagcaagcgagtcgtcaggatttgtaaaactaatggatcctatatacgtacca
gaagcacctggaattccacgagttacagacagcacaaaatcttctgtttctctgcgatgg
acgagacctatgtatgatggtggtgctgatattattggttattctgttgaatatgctgaa
gtatcagaaaaggaagaagacgaagattttgaccaagaagctgttgtgtggggcaaagcc
gttgacaagacttgtcttagaaacacagcatacactattactggacttgtgcaaaacaag
agctaccgcttccgcgtgtgtgctcataacagcttgggtgcttctgccccggcgataact
gcaaccaaggtagtgccggtggaaaggtttgaaccaccaaccttcgggccagacactgat
cttagaaaaacgttatctgtcagagctggtggatctgttcgacttgctgttccaatcatt
ggacgaccagcacctagtgtgtcttggtcaagaacacataacggtttgaaggagcgcgca
attatcgatacaactgatactatgaccactttgcttattgaaaatgtgaccagagacgat
acggccaaatacacactcacactttccaaccaaagcggaaccattgctgccagtgttatg
gtcaaagtacttgatacgccagcagcacctgaagaacttgcgattaccggcatgtcaaag
agtgcgatttctgtatcttggaaagcaccggagatcgatggcggaagtaacatcaccaac
tacattcttgaacgaagagaagccaccaagaaagcgtggtctacagtggaaaccgcttgc
gcacgaacgtcgtacaaattcaccaaactcaatgaagggttccgatactacttcagagtg
atggcagaaaacgaatacggcgtcggagcaccggcacagaccgagcatccagtcagagca
tcagaagagccaggcccgccaaagtcaatccaatgcaccgatattacaaaagacagtgtg
tcattgcagtggcagaagcctgactacgatggtggaagcgaaattcttgattacacgatt
gaacaacagctcaaaggatttgatcaatggaccaaggtcaaggtagtcaaggcatcgctt
cacaactacgtggtaacacatttgaatgagaaccaacaatacaccttccgtgtttcggca
agaaacgatacaggaactagtccatcgacagagctgtcaggatacgttcttgttgttact
caaactgcaccaccggatgcggaattaggtggttttagccaaaaacttgttgaagggaag
gctggtactaccattcaagcttcaattgtaatcaaaggtaaaccagcacctacaaccgaa
tggaaacgtgaaggtgaagagctcaagatgaccagcagaatcaactatgaaactgttgga
aatcaagcggttcttacaattaaggacgcagaactgaaagatgcaggcaactaccaactg
ctcttggaaaatagcgttggaagcaagacaatccctgtcgttgttcgagttcttgataag
ccgggtgctccgaagggtccagttgagttctcaggagtgacttcagattcgcttgtcctg
tcatggagttctcctgaagctgatggtggtgccgcggtcaacaactatattgttgatatg
agggaaacatcaggtgatgcaactgaatggagaatgatatcgggatcgacagcaagaaat
tctctgaaggtgacaagacttataccaggaatggattatgctttccgaatccgagccgag
aaccgatttggaatcggaaaaggtttggaatctggttccatcaaggctcagtttccattc
aagacacctgggtcgccaagtgcaccaactatcattgctactacacgtgagactatgacc
atcaaatgggaagcaccgatgaatgacggcggttcgaagattctgggctatcacatcgaa
aagaaggacagaaactctatcttgtggatgaagtgcagcaaaaccttgctctccagtaca
gagtacaaaatcaccaacttacaagaaggtcttgaatacgagttccgcgtgtatgcagag
aatgctgcaggttgtggaaagacaagcaagccatctgactctgctgttgcgcgagattca
gtcgatccgccacaagatgtagaagtcgttggaatcaccaggaattcagctcatatacaa
tggaagaagccagagtatgatggtggatccagggtaactggttacatcattgagcgaatg
gaggttccagctggacgatggctcaaatgtaactttagcaacgtgtcaatcaccaacttt
aacattgaaggcctaactgaaggaacgaaatatcaattccgagtttgcgccaagaacgca
gcgggtgctgtaagcattccatgtatgactatactacctgtgcttatcaaggacgattta
caaccacccacaattgacatggacgcaaggtttgctgagctgataactgtacgagctggc
agaactattaagcttgaagctggtattcgtggcaagccgacgccaacaatcacatggaag
aaagacgaacaggagtttaaaacaaccgggcgaattgttatcagaaataccgacatctcg
tcctgcttggaaatcagtgatgcagataaagaagacacagctacttactcgctcactgtc
cagaactttggtggttctcgctcactatcaattcaagtcaaagtacttgacaagccagga
gctcctacaggacctgtacaagtaaccggtatcacagctgagaagtgtacgatcaagtgg
agtccacctaagcgtgatggaggagcaccgatcactaactacgttgttgagaagcgtgaa
accagtcatttggcgtgggtgcttgtaaacccaagcgtggagggtacaatgtgcaaaata
agcaaaatgcttgctggcaacgagtacatcttccgtgtacgagctgagaacaagtacgga
gtcggtgacgctcttgaatccgaagaaattcttgctaagaatccattctcaacggcttct
gcaccaacttcagttgaaatcacatcagtaaacaacaactctgttaccttggcatgggct
cgaccaaagcatgatggaggctctgaaatatcaggttacgttattgagaaaaagatcaaa
tccggacttcgctggattagagcaaacaaaaagcccgtattagatatgcgatacaaggtt
ccagaactcagcgaaaaccaagagtacgaattccgagtttgtgccgaaaacgctgctggt
actggaccgatgagcgaggaaacgccgtatgttctcatccaggacccgaagtatccacca
gaagcacccattaacttaagagtggaagacacaacaaagtcttccgtcagtttatcgtgg
atcccgcccaccttcgatggaggcagtgaggttatgggttacgtggttgagatgacagtt
actaagaagcgacgaacacactcacagtcgtccacatctactgttatgacaacgaccacc
attaccactgttgatggggtagaagaaatacttgacgacgagcagcgacttgacattcac
cgagaatggactcaagtatctggcaagacccttgtacaagacacggaatatgttgtaact
ggattgaaggacaagaccgagtatctcttccgtgtagcggctgtcagtaaagttggtacc
gggacaaaggctatgctgcgcatgcctgtcatgtgcgttgaaaggttggaaatgccagaa
ctagttattgatgaaactgttcgccgaaatgtcactgtcaaagctggaaaccaagttaga
cttaaccttggattccgtggtcgaccggcaccgacgattacttggtcaaaggcagacacc
agtgctgaaagcctgaaacagcgaggaattgtggaaacaactccgtatactacatcactt
acaatcagcgactcgacaaggttcgatgcgggcagatacatggtcactgtggaaaacagc
gaaggatcaaaggactttgcatacaacgtcaaagtacttgatacttcaggaccagttacc
gacttgcaggtggtcgaaatgactcgtgacagtgcaaccatcaagtggacaactcccgaa
aatgacgggtgctctgtgataaccaactacgttgtgcaaaagcgagaatcatcgcgcaaa
gcttggaccactgtttcaagcgaatgtacaagaaacacatacaagattactggtttaact
gaaggtgacacttacaagttcagagtcatggccgaaaacgcccaaggacttggtgttcct
acagaaacatccgaagccgtcaagatttcaatgaaaccgtcaagtcctggaaagatccag
cttaccgatgtcactaaatcaacagtttcgctcgagtggaccaaacctgaacacaacgga
ggaagcgacatcaccggttacgttgtggagatggtactttctggatttgaaaagtggcag
cagtgtgcgtctgtgaatgctctgtcaaccacccttaaaggattggaagaaggccgtcag
tatcagttccgtgttcgtgcaaagaacgacaagggactcagcgacgctgcgactttaaat
catatcgtgacgatcaaggatattgttgaagggccgattataaacctacgggatctaccg
gttggaggaatccacagcaaagcaggaacaagtatcaatatttcaatcccagtttccggc
aaaccgaagccagaaattttgtggaagaagaatggagagccaatcaaacagaccacacga
gtttcgactgtgagctctgccattcagacatccatttctatcaaatcgtgcaagcttgaa
gactctggaaaatacgagatcacagctacaaatgcttccggtaccgcaaagggtgtgtta
tcgattgctgtattggataagccgagcaaaatcactgatttgtccattgagtcggtgacc
gaaaattcggttagccttgtatggcaaccgccgcaagaagacggaggatgccagattagt
aactacgttgttcaaatgcgagatgccgaatctgacgtttgggttgactgcgctgctact
gctgtacgaccaagaataaaggtgaacaagctcacaataggaaaagaatatcaattccgt
gtatcggccgaaaaccgattcgggtgcggagaatttgtcgcttccgaaaaggtgttggtg
aaatatcctttcagcaaacctggaccaccaggtattcctaaatctactttggtctcgtcg
gatcacgttgttctgcactggcacgaaccagttcacgacggaggaagcccaatcatttct
taccacgttgagatgaaggaccgaaacagtatcttgtggcgcaaggtcaaccgaatggac
gttcgtgagaccagcttcaaagcaacgggtcttcagccaggtcttacatacgagttccga
gtttatgctgagaatgctgcaggctgtggcaaaccaagccaatcgtgcgaccctgttgta
gccagagaccaaatatcaagacctctggccgtagaaccaacaggtgtaactcgaacgaca
gtcgatcttgtttggaggaaacctgaaaacgatggtggcgcaaggatttctggatatgtg
gtggaacgaagagagttgccaagcggacgatggcttaagtgcaacttcagtaacctgatt
gaatgcaagtacactgtcacaggtttgactgaggacatcagttatgagttccaagtcatt
gcgaaaaatgctgctggttccgtatcagagccaagtgaaccaagcgaacaagtcacctgc
aaagattcgttcacccctccacgactcgacctcatgggtaacttaaaggacaccattgtt
gttaaagctggtgaggcaatcactttggcagcatccatctttgggaagccatgcccaaca
gccacttggagccgcaataacgttgaacttgacaacacaccaaaaacagagatcactgac
acgggatctacaacaacattatccatcaaggattcaactcgggatgatagtggcgactat
gttcttcacttgaagaatactgctggttcacgttctatatcgatcacagttaaagtacta
gacaaaccagggcaacctatcggtcctttagctgtaagcgaagttacatccgaaaagtgc
aggttgtcgtggcgaacaccagaaaacaacggaggtgcaccggttacacattacaacttg
gaaaaacgtgaaacatctcgtttggcttggactcttgtcgaatctggtattgagggtgtt
accaccaaggttcaccgtcttctcaaagggaatgaatacatcttccgtgttattgctgtt
aacaaatatggcccaggagtgccattggaatcagttcctgttacggcaaaggatcctttt
actacaccgggagcgccagggaaaccacaagtctcgacagtgatgagaaattcagcagtc
atcacatgggctcgcccaagcaccgatggtgggagcgaaatcaacggttaccatattgaa
cggaaggaacgaaactctttgagatggactcgtgcagtaagacgagcagtaccaagtctg
caccacaaagttacagggttgtccgaaggcgcggaatacgagttccgtgtttcagccgaa
aacgcagcgggaattggcccgacttcagaatgcagttcgcctgttctttgcaaggaacct
gtctacgttcctggaccaacgggtatgccaaaggttttggacacaacgaaacgaagcgta
actttggcttgggcagcaccatcatttgacggtggttcgaatgtcacaggttaccagata
gaggtttgccagaaggacgcagatactgaggaatgggccaaatgtacaccaccaactgga
atcaaaactaccgaatttaccgtaccagacttgcagcaaaacaaggaatacaagttccga
atctctgctttaaacgtgtgtggtattggtgaagctgttcaactcccaatcgcagtagag
accaccgacaggctcgaagctccagaaatttctcctgatggtgatttaagaaagaacctt
acggtaaaatctggcagtccaatcaccttgactgttccgatccgcggaagaccagttcct
acagttcgatggagcaaggaaggagcaccaagtgttggtgaaagaacacaactcgacaca
acagaaactggaacaactctgtttatacctgaatgcaatcgatcagattctggaaaatac
acgcttacattggacaacagctctggttcgacgtcggcaagctgctcagtgaaggttcta
gatacaccaggcccatgccataacctttctgtaaaggatgtgacaaaagactatgcaact
gctgtgtgggaacctccaacaaacgatggcggaagtcatatcaccaactacattgtggaa
aagaaagaaaccggccgcaaagcttggtcaaccattacaaccggatgccaacgaacacac
atcaagattaacttgagcgaaggtttaacttacctcttcagagtgatggcagaaaacgaa
aacggaattggcgttcctgttgaaacaagtacaccagtcaaagctacagaagtacctggt
gcaccagaccgtttagaagttgtcgatgtgacgcggtcatctgttgctttacagtggaac
aagccagaggttgatggtggttctaagattctcggttatattatcgagtcattggaaaag
gatcaaaacaaatgggtgaaacgcataactgtgaaagaacctttggcaaacattacaaac
ttgaaagaaggacaagaatatgcattccgtgttgtttcactaaatgaagttggtgcatca
gatccacgagaagcaagttccctagttttggttcgagacacttttgtagcgccatcattg
gacttgtcgcagttgccccactcggttgctcatgtgaaagcaggagataatcttgatgtt
cgcgtgccgtatactggcaaaccgaaacctacgattaaatgggtaaaagacaacgccaag
gtacgaatcacaaagcgagttgacactgacagcgatgaagaaggaattgcaagcttgaaa
atccaaaccgtgacacaagaagacgctggtatttacgaacttcatgcagaaaaccaaggt
ggaaaacgatgcgcgaagatttcagtcattgtactggacaaacctggtgcagtagaagaa
ctacagacatcaaatgtgacagaatcatcagttacactgtcgtggaaagcaccagcgttt
gatggcggttcggcaatcagttgctacgttgttgatctgcgaacatcggaagaagcagaa
tggagaatggtttcgtcagcaattgtgcgaacaacatttaaatgcacaaaactcgacctt
ggaaaagaatatactttccgtgtccgagcgatgaaccgatttggacttggccctgtatct
tgtacagaaccagtcacaatcgaattgccatacaaggttcctggagcaccagcagcttgc
actgttagttacgcctgcaaagacgcaatggtcgtgaattggcaagagccggtaaaggat
ggcggtaatccagtgattggatatcatctggaagtgaaggacaggaacagcattctgtgg
aaaaaggcgaaccgtggaattattcgaagcacacactaccgtgtcttgggacttcaagaa
ggcttggagtatgaataccgtgtcagcgctgaaaacgcagctggagttggtaaaccaagc
agaccatcggaagcggtgtttgctcgtgatccagtcgatataccacgtgaggttgaggta
gtcgatatcacacgatctacttgccttgtacgctggaagaaaccagagtacgatggtggc
cagaagattgtcggatataacgttgaaaagagagatctacctgcaggtcgttggaccaag
gctagcttcaacattattccagacaacgagtatctggttactggattgaatggtggagcc
gagtatgagttccgcgtccttgccaagaacgcagctggaatctttagtgaaccatcagct
agtacaggtgccgtgagatgcgaagatgacttcagacccccaaggattaatctcgatgcg
catttgcttgacgaagtgaccgtatctgcaggatcaactctgcgtctacacgccggtatt
tcaggtaaaccagagccagcaatcacatggtctcttaacggaaaggacattagagaagat
cttcgtcatatcattgacacgactatcgaccactgcagcattctcattaaagattgctcc
aaagcagactctggtgtgtttacaatcagcgcaaagaatgcgtgtggcgagaaggcggcc
aacatcaaagtccttgtgctcgacaaaccaggatcacctacaggcccagtgaagttttca
agaatttctgattcaagagttacttgctcgtgggaagctccagaacaagatggcggatcc
aagatcactcactacattgtatctaagcgggaaacctcaagacttgcatggtcggtggtc
agcgagaaggaggacttgtgtacacttactgtgcaacgtctgataaaaaacaacgaatat
cagttccgtattcaggccgtgaacaagttcggtgttggtgaaccacttgactccgagcca
gtggtggcaaagaacagcttcacagaaccatccgcccctggaatgccagatgtaaacaat
gtgacggcaaccggatgcaccgtgatgtggagacgacctgagtcggacggaggagcagat
attgacggatacattctcgagagacgagaaaagaagagttcaaggtggatcaagtgcaac
aagaaggatcttcgcgacttgcgcttcaagattgccaacctgagcgaaaacaacgagtac
gagttccgtgttgccgctgagaatgctgctggtattggagcatatagcccgatatcgttg
ccagttgtgatgcgtgatccaatcgatgtaccaggacctccaagtagcccgaaggtgcgc
gacactacacgaacatccgtcgttttatcctggtctcacccagcatataatggtggtagt
gcagtcattggttatataattgaatcaaagatcgtcgaagatgaagaacaagaaccacaa
caacaggaagaagatgaaacttcctcttccatggctgaagagaaaggctggaacttggtt
caatccaacgtgcttggaaccaaatacacaatcgacaaactaaaccatgacacaatatac
agattccgtgtatcggcaattaataagggcggcgttggtttccctgccgaggtggtcggg
gcaatcaaacctgtagacagactggacccaccagaatatgacctagacgcttctctgagg
aaaacagttttggtccgagctggaaacacagtcaacatctcaatcgctgttaaaggtcga
ccgactcctaatgtgacctggacgaaggacaacgttaatgttaccactaatcctcgcgtt
catgttgacaatgtggatggaaagacaattcttgttgtacaggattgcacaaggaatgat
actggaaaatatgcacttgcgctggaaaatgcaagtggtgtagctaacacttttgtcagc
attcgtgtactggacactcctggtcaaccaggctcgctcaaggtgaaacaaattacaaag
gaatacgccattattacttgggatgcaccgcttattgatggcggctctgaagtgtttaac
taccacgtagacaaacgagaaacaacacatcgggcctggtcgtcagtatctagggactgc
aagcgactcacttggaagatcgatggtcttaacaaaggaagcagttacttcttccgtgtt
ttggccgaaaacgagtacggtctcggtgtcgcggcagaaaccgaagcggtgacagctaca
gaaattcctgacagtgtcaatgatctaaggattgaagatattaccaacaagtcaatcacg
ctgacctggtccaagccggactctgatggtggtacaccaatttcaagttacattgtcgaa
tatcgagttaaagacgctgagaagtggacgtcggtaaaaactcggcacacttcaacagtt
cttgaaaagttgaagacgggtgaaaagtatgagattcgtgttgctgctgaaaacgaagct
ggaccaagtgaatgggctttgatcggaccactcgtggcaaaagaacaacagattctgcca
gaagctgatctaagttctattcctggaaggagcattaatatgagggaaggtggaaacatc
agacttgatattccattctacggaaagccgagtccatccattaagtggagcaaagatcga
atcccattgaaacaaggcgaacgcgttgcattcgaacgtatgcgcgacgtcgcattgttg
atgatgaaggatgtcaagaaagcggacgctggtcaatatattcttcaccttgaaagcgcg
gctggccgaaaagaagctgcgtttacactcaacgtatatggaaacccaggaaagatcaag
ggcgtgatcgagttccttgagattactgcaaccagcatcgtgttgaagtggtcacctcca
gaagacaacggaggatctgatattacaaactacatcattgagaagaaagaaacaaccagc
gatacgtggtcttctgtaaacgccaactgcagcaggacgaccgtcaaagcaattaagcta
aaccagaattcggaatatgtgttcagaattgctgctgagaataaatacggacttggagag
ttcactgaatctcccgaagtcgttgccaagtatccattcagaaatcctacagtgccacca
cagccggaggttgttgaaatttccgccgattccatgactgttgtgtggatggaatgtcat
tccgatggcggttctgaaatcactggttaccatgttgaaaggaaagaacgaaacgcaatt
ctctggaccaaggccaatcttgccactctccgtacacgggaattcaaagcaactggttta
attgaggggcttgagtatcagttccgagtctatgccgagaacatggctggacgaagccag
gcaagtgagccaagtaagcctgaaagagcacacaatgttgttagtcccccaagctgccct
gactggacagacatcactcgtgattcagtcactctcgtctggaaaccaccaaaatcggat
ggcggaagcaaaattattgggtacaacatcgagaaacgatcaggagctgatggaagatgg
ctcaagtgcaactacaccaatgtacaagaatgcgagttcaccgcaaccgctcttaactcc
ggtgagaagtaccagttccgtgtaactgctagaaacgcctcgggaactgtgagcaaacct
tcaataccaagtgctgaggttgtttgccacgatgacttccaaccaccgatgattcagctc
gacacagatattcttgacggagtcagcattcgagctggtgttacactcagacttaaagcc
actgtaactggaaaacctgcaccgaagattgtttggacccaagacgggaaggaacttgtt
tcaaatgcacaaactgaaatcacaaagaacaaaaacgtcagtttggtaacgatcaaagac
acgagtagactcaacagcggtacatatgtgattactgcacgaaacccttgcgccacaaag
gacatggacgtgaaggtgactgtattggacaaaccaggaccacccgaaggaccagtcaag
tttacatcactaacaaaagacaaggttactctatggtggggaacaccaaaagacacaggc
ggggctaccattgaaaactatgtgattgaaaagcgggaaacaactagattgaactgggct
ttggtcactgcttgctgtgaatcgacaaaccaaacggtaaacaggttgatcaaaaaccat
gaatatcagttcaggatatctgcacaaaacaagtacggtgttggtgcgcctcttctttcg
gagccggtggttgcaaaggtcaactacacagtaccaagcccaccaggccaaccacaatat
tcaagctcgactacggattcaataacaataacgttcagtcggccaacaaatgatggcggt
aacgatatcatcggttacaacgttgaacgtcgagagaagaagagcatgagatgggtccaa
gtcacaaagaagttaacgacagagcttcgatgtcgagtgccggctctcactgaaggaagt
gaatacgaattccgcgtctttgccgaaaacgcagctggaccaagtaaaccaagtgaaaca
tcgtctctcattgtatgtcaagagcccattgggccgcctggggcaccgggtgttgcacga
gtgactgacacaacgagaagcacaattgcgctaaattggacgccgcccatgtacgatggc
ggaagcatcgttattggatacgttgtagaagcacgtaaggttgtagcacagccacaacag
gagactgaacaacaaaccgaacaaactgaagaagaagactggattcgaatcaatccagat
ttcatcagatcatgcgagtacattgttcctaacctacaagctggagccgagtacaacatc
cgaatccgagcagttaatgctgctggagtcggtgaggcaactcctgtgtccggtaaaatt
atggcaactgacaaactggaagttcccgacttccaaatcgatgcagatttcaaatcgcat
tacgttgtgcgcgccggagcttccttgagactatttgttctctaccacggacgtccgcga
ccctcagttacttggtcgaaaccaggcactgaacttcaggatcgagctgagattcaaact
actgactacagcactcttctgttgattaactcaacaacccgcgacgattcaggaaaatat
actcttacccttgaaaacagcgctggagaaaagaaactgcacctgaccgtgaaagtgctg
gataccccaggaccagtatcgcgtattggatgcaaagaggttaccagcaactcaatcacc
attaactgggatgctcctttgatcgatggtggagcgatcgtgaagaactacatcatcgaa
aagagagaagtatcaagaagaagttggcaaacagttgcaaccaagtgttcaaggaccagt
ttcaagattacaaaactacaggaaggcaccacttacctgttccgcgtgttgccagaaaac
gaatacggaatcggtgtgccgcgtgaaactgaaacacctatcacggctacagaggtaccg
gccattccgggccgattggacattgactcggttacaaagaatactgtcacgttgtcgtgg
acgaagcctgaatacgatggcggcagcaggatcagttcttatctgattgaagtttccgag
aaaggatccggcaagtttaccgactgcggccgtgtgaagggcaccgtgttccgtcatacc
attactaacttacacgaaggatcagaatacgaattccgcgttcgagctaagaacgaagcc
ggagctggagaagcacgagaagctttctcttcagttattacaaaagatgaacttgttgta
ccagaagctgacattcgacacatttaccataagacagtaaccgtcaaagcaggcagtccg
atcgaagtcaacatcccgattattggcaagccgcaacctgttgtatcatggatgacaaac
ggaaaagccctgaacgagagcgaccgagtcgccatgaagacaacagccgattcaacgtcc
cttcgtgtcaaggactcgaagaagacggatgctggcacttacaccatgcttatcaagaac
aacgtcggtgaaaagtcgtacaaacttgaagtggtcgttttggacatgcctggacctcca
gctggagaaatccagttcctcaacgtgactgcagacagcatcacattgtcatggaatcca
ccaaccgatactggaggaagcgaaataacaaattacgccgtcgactaccgagagttcgga
cgttccacttggtctccagttacatcatgtacaacaagaaccacagtaaaggttaacaag
ttgcaacgttacactgaatatcaattccgagtcatcgctgagagcaagtacggccttgga
gaaccgctgctatcagaaatatgcagagctgattatcaatacactgcaccaagacaacct
ggcacaccagaggttcgtgaagtcaccaaagacacagttacgatcacctggatggaacca
actcatgatggtggaagtccaatcactggttattacattgaaaagaaagagaagaactcg
atcttgtggcagaaggacactgaaaaggcaaccccgaaacttacccatacaatcaaaggt
ttgttggagggtcttgagtatcagttccgtgtcctcgctgaaaatgaagctggaatcagc
aagccaggtgatgcaagcagaccggtcgaagtcattagcgctgttggtcctccttacgac
ctggagatcgttgatatatctcgccactctgctatcctgcaatggaagaaaccgctggct
gacggtggaagcaagattgcctattatttcatcgaacgccgccatgtacctgaaggaaga
tggcttaagtgcaactttaccaatgtcaccgcaaccaccttcgaggttacaggactcaca
ccaaacgactcttacgaattcagagtcactgcacgaaacacaatcggtacaatgggtcag
ccgtccgaggtactaggccctattgtttgcaagcctaagtacaaggctccaacaattgaa
ctagacagccggttcatgtcggatgttgtgcaaattcgagcaggcaacgtgttgagactg
gaagctgaaatttctggaaagccacaacccaatgtattttggtcgaagggcgaaaccgac
ttggaagacaacgaaaagataactattgtgaccgccggcaactctacagcgctggtaatc
aaggacattagtcgcgaggacagtgcccgatacacactgttacttcgcaacgagtgtggt
gaaaagagaacttcaatcaatgtgaaggtactcgacaaacctggcaggccaaagggtcca
attgcatttagccgagtgaccgctgaaaaatgcaacttatcctgggagcgacctgaggaa
gatggtggtgctgaaatcagccattatgttgttgaaaagagagaaacctctcgaattagc
tggatcgccgttcacgagacacttgagcacacttcatgcacgatcccgaacttgattgtc
aacaacgaatacatcttccgcgtttcagcggtaaacaaatatggacaaggaaaaccacta
gaatctgaaccacttgtggcaaagaatcaattcgttgcaccagatgcaccgggacaacct
gagattgctgcagcaactaaagactccattactatcacctggacacgaccagtaaatgat
ggcggttcggacatcaagaattacatcattgaaaaacgtgacaagcaaggctacagatgg
atccgatgtaacaagacgcaggaggttaccgacctccgattcaaagcaactggcttgaga
cacaaatcgatggtagagtttagagtagctgcagaaaatgctgctggaattggcgctttc
agcgatgcaagtgtatgcggatgtgtacaagatccagtctttgctccagctgctccggtt
catctcaaggtaacggactctacaagaagcagcatcagtttggcgttggctcctccattg
tttgacggtggttctccggtcgatggctacatcattgaagtaacagaatgcaaagctgaa
catgcggacgagtggcagaagattcacaaatccaactacattcaaagcacagaattcacc
gcgactggattgaaacatggttctgaatacaagttcagagtgtttgcggtcaacgttaat
ggtgtaagtgaagaaccagcaactttcactgacagcgtctttgcaaaggaaattgttgaa
gaacctgagctcgaacttgacgacacattccgaaagacggtgaatgttcatgccggcaaa
ccattacgtttgtatgtgtttgttaaaggacgacctacaccttcagttacctggaccaag
gcaccacatggtgaagagctttcgtcaagagctttcattgaaactcatgaagctgctagc
aaacttgagatcgaaaaggttgatcgtcatgatgctggaaaatataccattgccgtcgag
aacgcaagcggacgcaaagaagcttctattagcgtacgggtctacgatacaccaggacca
cctggtccaattgtaatccgtgaagtgacaaggaactctgtctcatttgcttgggaatca
cctgagatagatggtggcagtgctgtccgaagctatgtcgttgaaaagcgcgaatccact
cgacgagcatggagtaccgtcacaacaaaatgctcaaagatgagtttcaagatcaacgat
ctgattgaaggagtttcctatttcttccgagttctcggggaaaacgagcacggagttggc
gagggaagagaaacagaaaacgccatcaagatatcagaacaaccttcagttcctgcctct
gtcgaagttaccgatgtcacagccagcagcgtctcgcttgcttgggaaagaccagaacaa
gatggtggatctcgtattgagggatacattgtcgaggttatggagaaaggtaaagaacaa
tggatcagggctggaaagacaaaggagcaacactacactgttaagggtctgaaagatggt
ctcgactattatttccgcattagagccaaaaacgagagtggactcggcgatgcacgtgag
ttgctatcgtccgttaccgtgaaggaacaacttgcttctccggctgttgatatgagcagc
ttgccgcagaagacacttaacgttaaagctggatcaccaatccagttgaaccttcctatt
tctggccgaccagcgcctacagctatttggacaaagaacgaacaaccaataaaagaagat
ctgcatcgaaccactgtcaagtcaacggcaaccaatgcttcgttggagattcgtgaatct
acagtcgaagatcgtggcgattaccgcataacactgaagaactcttctggcacatgcaca
caacttattcgagtcgttatacttgatgtaccgcaaccaccagagggaccagtggaagta
tctgatattacttcgacatccatggtactaaactggaagctaccaagctacgacggtgga
gcagccatcagtaattatgttgtggaaaaacgagagagccatcgacccaattgggtttgc
gtcagcggaacagttactaggacgaacatgaaagtaacccacttgaacgaagattctgaa
tacgttttccgcgtactcgcgcaaaatcgatttggagtcagcaagccgttgatgtcggat
gaagttgtagctcagagtcaatatggccttcctggtgcaaccggtgccccgcaagttagc
tcagtaagtaaagatagccagacaatcgtctggatggaacccgttaacgatggtggaaca
gaaatcactggctacatcgtcgaacgcaaagaaccaaaagcatcacgctggatacgagcg
acaagaacacctataacacagacccgttatgtcagcagtggacttatcgaaggtgtcgaa
tacatccacagaattattgctgtgaatgctaaaggagaaggaaagccaagcaaggagact
tctcctgctacttgccaagaaccagttgctccaccaagcgcgccaagaaacttacgcata
gtggacatgacaaaagcatcattgtctgttgcttgggacaagccagaatacgaaggcggt
tccaaactacttggatactacatcgaaattcgcaaagatggttcatggtgggaacgatac
aatgcaactccaatccgcatcacagagtatacacttaaaggaatgcccgaaggtgacgag
ttctatcttcgcattcttgccattaacgcaggagggttccggaccaccgatggaaatgga
aatgctattgttgtgaaagatcaaagtggtccaccagaagtattgaaatctttcgaagag
ccaattgtggtcaggaaaggcggagtaattagcctccgggttcctttcaaatgtcgacca
tcaccacaagcaacgtggaagaagatttcaggtcctgaagtcgatctcaaccttcgggca
atgatagcacttcaaactgatgtcgctgagctggtcatcaaaggcgtagatcgtcgagat
gcaggagaatacgaagtgaccctatctaacaagcttggagagaaatcagtggctattcgt
gttcaagtaatcggaaagcccgacgctccagagggcccgctgcagtttggcgacatgcaa
gctacgtcactgaacatcgtatggaaaccagtgattaacgacgggggaagtgaagtgacc
aactacgttgtagagaaacgagaggttggaaaaacagcatggacaactgtcgactctaag
attagatcgacccaatgctgtgctaaaggtctcacagaaggcagtgaatatttcttcagg
gtatttgcagaaaacacattcggattgggcgacgctcttcaatgcactgagacagtcact
cctaagaatccactattcacaccacagccaccacagcttgttgaaatcaacgaggtgagg
aaagacaaagtgttccttgcgtggacaaggtcgcgtgatgatggcggttcaagggtaact
ggatacttcgttgaacgtaaagaagctggatcagatagatgggtccgagtgaacaaggtg
ctgaccaagaatctttcatttaccgttcaaggattagtggaggatgctgaatatcaattc
cgcgttgttgctctcaatgatgtgggagaaggtgaaccatctgaaccaaccgagttgatt
cagtgcaaagatcctttcgataaaccatcatgccctgaagacattgaagtacatcatgta
accaaagactccgttacattggcttggaacaaacctgagttcgacggaggaaagggaatt
aagggatatgccattgaacaccgagaattcggaatgacaatctggaagcagagtcacgag
gacatgatacgggatcgaatttaccaaatcggaggtttggaccaaggagcagaatacgag
ttccgcttgttcgctattaacgagcaaggaaaatcccgccctaagatgatggagatgccg
gtggccactaagaaagctgctggtgagaagccagaaattgtagaagctttgaccactgtt
gttggcgtgcgggaatcaactgctacactgacatgcaaagtatctggccggcctatgcct
gatataacctggataaggtacggaaaagaattacagagcggtcgcaagtacaagatgatt
tcagaaggacaagtcaaccagttgaacatcattaactgttgcgatgaagacgaaggttgt
tactctatggtagcaaagaacaacgttggatctgctgacacagagggcaaggttgttgtt
gaaggcgtgccggtcttggacaaccgaaacttgaggttcaaagatcatgtcatcggtaag
aacggccaaacattaagaattcacgttccgtatactggacgccccatggcacaagttgtt
tggtcaaaggaaggacgtcgattcgacaagagtgatcgacatgagattgaaacgaccgaa
acgtacacgcacctcgtgattaaaacatcggacagaacgaaggacgtaggaaaatatctc
gtaaagttgaccaacgctcatggccacaacgtttactcgattaatgttgaaatacaggat
gtaccacacccaccaaccaatgtcgaagtatcagacatcacatataagagcatggtactc
aactggaaagcgccagaagacgacggcggtgctcctgtttcaaactatatcgtggagaaa
cgcgacattgaagacgaagaaggcaaatggtctcttgtaacttcccgcgttgcacaaact
tcatacaaggttgaacgattggtagagaagcatgcttactacttccgtatttcggccgaa
aattgcttcggtgtttctaagcctttggaaaccgacgccccggttgcagccaagccacca
cacaacgtaccagaacagccaacacagcttatggtgagcggtgtttccaaaactggatgc
acactcaactggaaacaacctaaggatggcggaagcagaatcacaaactacaccattcag
cgaagagataccaaacgacctcgctggagacgaatcaacgatgagactcacacacagtca
gtatacaacgttactggacttgtggagggcattagttacgagttccgcatcattgccgag
aacgccgtcggaccttctgaaccatcggatgtatctgagcaggttctacctaaagacgac
atcagaattgctgctcctaaatttgccgagtcgatcagagatttggttgtcaagccaaat
tcaaacgcaactttcagctgcaaggttactggtcaaccaaaaccgatcattaagtggtac
aagggaggcaaagaaatgacaggatgttctcaatacaagatatccgaagccaagggaaat
cattacaccttggttgtacatgatgttactactgaacaagaaggaccatacaccgtccgt
gcaactaaccaaggaggttcaatctcacagacagttgatctgattgtccaacttccagca
aaggttaacttaccaaaatatatgatgactgaagctacagtatgcaaagtgcacgaagtc
gttagcatcaaagttccaattgaaggtcgtcctcaacccgatgtcacgtggaccaaagct
ggcaaattggtgtctgccgatcaccacagacagttcattaccacgtcgtccttcacatcg
atgactattaccaacgcagagcgaaacgattctggtttctacaacgtgatagtgaaaaat
cgcttcggtacaaaccaagctactgttgagctgctggttggagatgtcccagctaaacct
gagaacctcaaggtgtctaatgtcacacgagattcagttgacttaacctggaaggaacca
tcagataacggtggcaaacctgtcctgaagtatgttatcgagaagagcacaacatccagc
gatagatggttgaaggtttcatcgtcaggcacgtgcaagtacactgtatgcaatctctcc
ggaaagacaggatatctgttcagagtcctcgctgagaacgagtacgggcagagtaaacca
tcaggtccgtcagatgctgtaacaactaaagaagatcgaatgatggcagccaactacgat
gatatggttgatgctacagagaaatttgtggcaaccgaagcagtagtcaacaagagcagt
gttcttgataaataccagataatggaacaacttggacgaggaacattcggtacggtacat
cgtgcacgtgagattctcacaggcaagaccttcgctgcaaaactctgccgatttactgat
gaagccgaaaaggcgccaatcaacagagaagttgcaattatgcgtaaactgcagcatcct
cgtgttcttcagttgcatgaagtattcgataccaagggtgaaaccgcgctcgttgtgcag
ttcgtgtccggaggagatcttcttgaaagagtcattgcaacgaagtttgagctgaacgag
aacgtttgtgcatatctcatcaaacaggtgctcgaagcactagcttacgttcactcgcag
aacattgcccatctcgacatcaaaccagagaacatattgttcgtcactcgcaagagcagg
aagatcaagctcatcgactttggagtatcacgggaactgaaaacaggagaaggtctacga
atctcgtacggcactcctgatttctgcgctcctgaagttgtacaaaacgataccgtaggc
tgtgcaacagacatgtggtcggttggtgttctgacttaccttatgctcactggactgtcg
ccattccaaggcgaaaatgacaacgaaaccttacgaaatgtggctgaggccgattataac
ttcgaccacgaagcgtggagattcatttcggacgacgcacttgacttcattgacagactt
ctagttaaagagaagcgcgagcgaatgactgcggatgatgctcttgaacatccttggctg
cgaaccttgcatccagaagtagatgaagacctcattgagcgaagatctgttgcgatccag
accacactccataggaagttttaccagacgattaaaaagcaagacacctcaactgttatc
atctcattgggaagatacgcatctggaggagccttgcgatcactaaagggtaaatctgtt
gctaaggtcaaggtgcagtccgttgacatgacgccacaacttatgcctatgcaccatgtc
ttcgtgaaagaaaaggacgacgccaagcttacttgtcgaatccgtgacgccgacgatgat
gaaacaatcacttggtacaaagacaacttaaaacttgaagaaggagataaatatgaattc
tcatacgacacccacaccagctcagcctcgctttacgtgaagggaatcgttcgaactgac
gatggaacatacaagtgcagagttgagaacgcattcggttcatcaacacagatttgtgaa
gtttgcgttgaactgaaaactagagagtggactcgaactcgaagaagcatttacctgaac
cgacataagaaacgcggccgcaagacagctgcaagcgagatttctcgaattatcaagtgt
ccacccgagtttactttgccattgtacaacaggacggtttacaccggggacaccgctctc
tttaccataactgttaccgtgcacccggcacctgaaatcagttggttccacaatggtcaa
aagatcaaaattaatcctgatgacactcactactctgaaattcgtgaaaagggactttac
acgcttgagatcaggagatgccagctagaggattctggtgaagtcatcgttcatgctaag
aacgcttacggcgaggacgaatgtaaagcggcgctggttgtgcaagacaaaccactaaag
gaagacctcagtgttcgaccaatgttccgacgacttcttgctaaccaagaggttgatgaa
agcgagaacgcgaggttcgacatccgtgttactggattccccaaaccaacaattgaatgg
gagaaggacggtaaaccaattcgaccagaccaccaccacgacattgaatgggaagacatg
cattcttgctatctgctcatccgcgacaccttccaacaggattcgggacaatacaaagta
actgccaagaactcagctggtactgcaagttgtcaagcaacattacaagttcacgcaatc
acataccaaaaacgcaagaaagcaagaaaagatgctgacttgtttgcacgagaaaaggct
taccagttagccgacaaggtctcagtcctgaagggtgaatcggttgatgtgcgattcaac
gacgctgcaaaagaagcgctcctgactgcttcgacacaaggaatgttccaccgcgaaccc
atcagcgattcggaacagaaacttgaaaaagagagaatcaaagaagaaagaaaacgagag
ctcaatctgaggatgccttacgtgatgccagaaccactgcaacgatcggaaaagagtctc
aaagaggatcccgctctcaccaacttcgtaccattgagcgacttcaaatggtacaagaag
gttagagatgccaatgaagtttatcacccaacagatatatctcgagatgaacgaagatcg
taccgtgtgcgtcgccagttcgttccggatgtagcttacattgtaccagacaaacgtatc
ggatctaccagacgagagcgaccacgagtaatagacgacattatgattgatgattacgct
cgacaccgtgagccgaccctatctcccgacgaagaggagatcccacaaaggaagagacac
agatcattttctccaggtcgaaaacaccatccacgaccatttgttccacctgcatggaaa
caatacttcaagccgatgtccgatgatgagaaagtgcttcaaccagtgcagagttacttg
gaccaaaccaccgccaacgaatacatgcaggagatggaacaacgaggcgaagaaccgaga
cgtgaagaattcaaaagctactccgaacttctgcgcgaacagcgagaatctcttgcacaa
agagaagtaaaaactgttgagcaggaagatggtatctaccaatacaaaccgataaagatt
ccaaaacgtgacccgtattcgcaaacttaccaagaactgagagcgaaacacgatagcgcc
gtttcaagaaccaagaaactaaaaaccaccgagctcactagtggcaaggtcgttgatatc
gaatcggacgatgaactacttcgaccagttaactacgacacatggaagtatgccggtgta
aaaaccgaagccgatcttccaacaactaaaccagcacgccgacaacgttccacgtctgca
tcctctgctgcctctgaaagcgacggtgattttaattaccaacgcaaacgtcgcgagcga
gaacgaagaagacaagaacaagtcgatgaaatggaaatcgagatggaaatgattaaatcc
gcatcaaagaaacgcttcactaaaaaagctcgtgatgaggaaccagattacttgaagaaa
cttagacgacgaagatcatttgaattcgaagagctgatgcgaccagtcactgatgttgta
tcaaagaagaagaaacgacgaccagtttactcttcgtcctcgtcatcctcgtcaagcgaa
agcagcgatgaggaatattaccgaagacaacaatcaaggaaacaacgaaaatcaaaacga
tcaagacgatacgatgaatacgaggaagatctttcatctggaatcgagttcaccagctca
cgtctgaaagcaagaggtgaccaaggagtgacgtcatctgctgcagattacgcgccaaac
ttccaactgcgcatgcgcagccatgttgttcctgctggtatgagcaccaagcttagcgcg
tttgtgcgcggtcgacctgaaccacagatcacgtggtacaggaacggaacagaactcgca
tccggaggaactaaatattacgtcagcaacattggaggagtcacaacacttgaaattgta
cgatgccacgaaggagacagcggtacctaccgttgctcggctaaaaactacaagggcgaa
acatcagactacgccacactcgaagttacaggatccgagttcgagtccagtgcttcgaaa
cgaggtgtgcaagacttccacgtgagtttggacatgatcgacgcacgtacgagcatttca
agaaaccgattcgaaactgtgacacatctgacaccggccaacgaacgagtggagtctcga
agttcaaccgcatttgacgagcgaggactttcccgctcatctggattcagtccttatgtt
acatcagaaagtaggatgggaagcgcaactccttcgtcatctgctggagctccgtacttt
gtactacagccgaagagtcaatatgtgctcgagggagacgtggcaacgttttcagcgcag
tgcgacggaaaaccatcaccaaaactgacttggtaccacgatggccgtatcatcaaggac
aacgaaaaatacaaccttggtgcaaaccgaggaaagagaacgctggaaatccgagactgt
cgtcttatggatgccggcaactatcaatgcatcgctgaatccagcaaaggatccgcgacc
actgactttaccttggacgtgacaccacgacgacgaccaacaccagcagcaacttctgtt
tatgaaaaatcatcgccaatgggtcgagctgcatcaagacaacgcagagggcccatggtc
gtcggtcaactccatgttgagttgagactggatggtaaagtccatattgaatgcagcgtt
tcaaatccagacgatgtcaagcgtgtggaatggacaaaggacggtgcggcaattcgtttt
tcaagcggtcgcatgaagtctgaaacattcggcgcttgctactcgttgatcatcaatgac
ctctttgaggaagacgcgggatcatacgaatgtgagttgattggaaccaacggtggatca
tcaactaccacttgcagcatgtcaccgcaatcttgcgccagcatgcggaaaaagattagc
aaacttgccggcactcgaggtcactcgagtatggaacaatcaccgatgagtggtttgatg
cagcacatggaaagatccattgaacagacatcgaaaattacttcattttcatcaaaatca
tcttcgacatcgagcaaaggaaactcacctaaaattgaagcacttccgggatccgtttcc
gtttcaacaggaaaggttctcacgctcaccaccgccctctctggccaagcaccttgtgtt
gcggtgtggtttcacaacggaatgactttaaatgacggagacgactgtgggcgtattcgc
atcgacagcaacgacacctcaaccactttgaccattcttggagcaaaatcgaccgacgcc
gggaaataccggttggaagtcgcaagcccaaggggttcggacgctgcgaccgtggtagtt
caagtcaacatctaa

DBGET integrated database retrieval system