KEGG   Ciona intestinalis (yellow sea squirt): 100182203
Entry
100182203         CDS       T01056                                 
Name
(RefSeq) high mobility group protein 20A
  KO
K24660  high mobility group protein 20A
Organism
cin  Ciona intestinalis (yellow sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cin03036]
    100182203
Chromosome and associated proteins [BR:cin03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Other HDAC associated proteins
     100182203
SSDB
Motif
Pfam: HMG_box HMG_box_2 ADIP DUF4763 V_ATPase_I
Other DBs
NCBI-GeneID: 100182203
NCBI-ProteinID: XP_026693947
Ensembl: ENSCING00000018888
Position
1:complement(343979..345628)
AA seq 292 aa
MLRASPSMEKEDAGESTARKRGWPKGKKRKKFVKDENAPKKPLSGYVRFMNSRRDQVLQE
NRSLSFADITKLLGEEWTNMSLSEKSIYLDIAEKEKEKYWKEVEAYQRTDAYKVFVKKVN
EEKQAQKQAASNSSSKALSETEKPKVNNVSSSIPIFTNEFLEHNKAKETELHQLNKNNTE
LEQQNAILETHATNLRNAITKLDDETKSLSNKNEDVQENLNKLRKHLVNTFSTGVPATLG
TPNMENIDDYISDVCGFLQRSLYNDNETAASIHKVMSNLDPGILELISTVSK
NT seq 879 nt   +upstreamnt  +downstreamnt
atgctgagagcttcaccgagtatggagaaagaagacgctggagaaagcacagcgagaaaa
cgaggctggcctaagggtaagaagcgtaaaaagtttgtaaaagatgaaaatgcaccaaag
aaaccactttctgggtacgttcggtttatgaatagtcgaagagatcaggtcctgcaggaa
aatcggagcctcagttttgcggatattactaagttgcttggagaagagtggactaacatg
tcactaagcgaaaagagcatttatctggatattgctgagaaagaaaaagagaaatattgg
aaagaagttgaggcgtatcaacgcactgacgcttataaggtgtttgttaagaaagttaat
gaagaaaaacaagcacaaaaacaagctgcttctaacagtagctcaaaagcgctaagtgaa
acagaaaaaccgaaagtaaataatgtttcgtcttcaattccaatatttacaaatgagttt
ctcgagcataataaagcgaaagagacagagttacaccaattgaataaaaacaataccgaa
ctggagcagcagaatgctattcttgaaacgcatgcgacaaacttgcgcaatgccattaca
aaattggacgacgaaactaaatcgctgtcaaacaaaaacgaagacgtacaagaaaatctg
aataaactcagaaaacatttggtcaacactttttccacaggggtaccggcaacactaggc
acacctaatatggagaatattgacgactacataagtgatgtatgcggattcctgcaacgt
agtctgtataacgacaatgagaccgctgccagtattcacaaagttatgtcaaacttggat
ccagggatattggaattaatctcaactgtttctaaataa

DBGET integrated database retrieval system