KEGG   Ciona intestinalis (yellow sea squirt): 100186585
Entry
100186585         CDS       T01056                                 
Name
(RefSeq) membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 isoform X1
  KO
K05631  atrophin-1 interacting protein 3 (BAI1-associated protein 1)
Organism
cin  Ciona intestinalis (yellow sea squirt)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Peptidase_M50 WW Guanylate_kin
Other DBs
NCBI-GeneID: 100186585
NCBI-ProteinID: XP_018668120
Position
7:complement(1192124..1215388)
AA seq 1378 aa
MSSGKKHKHWSDRVHESVVSRNKTGQLNLVIKGGAEEIRFPFFGPVKQEKVIYHSGKIHD
GEILLEVNDQAVVGLTLYDLNNLIKQARDPVRFKTVKEGQTLTKDLKLYLSQRFNKGTVD
HKLQAAIRDNLYLRTLPCTTRSLREGEQDGVDYTFLSEEQFHELEKSGALLESGVYEGNY
YGTPKPPPVPLSPPIVRRSNSANDLPGMHPSSDGKRRRNRSNIEQQSSSSGSTPRRNHVF
PPNNKDGDKKTLSVTTKESSNPNGDLTPAESPKKETSIPHDQQNSDKILGPLPEGWEMGQ
TENGDCYFIDHIGKKTSWVDPRLEKMNRKSLLDCEDDELPYGWEKVEDAQFGLYFVDHID
KKTQFENPVIQAKREAGKSMEHPDLPSPPQSDNEEQNGSELHPQKNTNSDDSFQDNMSSQ
ENYVFTRDPSKLKGVSHLVPIEKSRRGFGFTIVGGDDPEEFLQIKSVVSDGAAAKSGNIE
QGDVIVKVNDTCVLGWTHPDVVKLFQAIPVGQIVTLQLCRGYPLIIDSDDPSTNLLTTYA
IRPEDKPTEEFNRQLRLLNTQLDDGSEVMGDMNGEALMSSPSKSMPNIADHPNTYYPNYG
QHNIGMLPQSTGFPTRAGSMGALPAPLVMQVIIKKGEQGFGFTISDSPQGQRVKQVLEAQ
RCHELMEGDILLEINGTTVQNMPHNNVVHILKDCPSNAAAIFVIQRGPLSTPMYDPEALM
GYQPGFANGVSHHPHAFQNHNQAIRARMKRSTTEPGLGSENGSVVSAPPSSSLGPPTSQH
PVNALLSEYRTKHHPANIRQDNYGIPVTYHPYRGQTIYHDPYVVTPQTDNYIYLTVVLRR
EETGFGFRILGGNFQDESVTIGQIVKSGAADKEGTLRTGDELLTVDGKKVTRIGHNQVIA
LMGNAARNAVVQLGIRRKETCTAAINLPHSRGPVMNPRSSSRPSSRGPPNTPVNEGQPFD
IIIHRREHEGFGFVIISSVKTSITGFQAPHKIGRIIDGSPAARCGHLRVGDRILAVNNVD
ITHLHHGQIVNLIKDSGFSIALHVLPIEADLDNSNRGSQSDSECFYVELPRSNKGFGFGI
RGGKEYNLPLYVLRVAKDGPAAESGQIRVGDILMEINGKSTIDIPHSQAINLIKQGGSVV
KLLLKHGDGNVPELGTPGANPSGSMQSLSSSALSGSDAANRAAQLMHFCHPEKVERPPPS
SHSSSKGKPPPTLPKPQTHNNSVRQLRRRANSSGQVLPPDPNQPQSTQLRRSMTPNPAKS
PREPIPISPNSDVAAPTPQPELQKAANSHPEQHFSNTKSPEPVETNHGPPSSNGLTSPTN
SKSSEKLSSPDKSTDTETTSPTSSTPTEENKKKSKKSTKSNKKSSKVGLWLSPKKKQK
NT seq 4137 nt   +upstreamnt  +downstreamnt
atgtcgtcgggaaaaaagcataaacactggtctgatcgtgtacatgagagtgttgtgagc
agaaacaagacaggacaacttaacctcgttattaaaggtggagctgaggaaatacgattc
ccattctttggcccagtgaagcaggaaaaagtgatctaccacagtggtaaaatacatgat
ggggaaatactgcttgaagtaaatgatcaagcagtggttggattgacgttgtatgatctc
aacaacttgataaaacaagcacgagaccctgttcgatttaaaactgtaaaagaaggtcaa
acacttaccaaggacctcaagctctatttgagccagcggttcaacaaaggcacagttgac
cacaagctacaagcagcgatacgggataatctttatctcaggacacttccctgcaccacg
agatcactgagggaaggtgagcaagatggggtagattatactttcctgagcgaggagcaa
tttcatgaactggaaaaatcaggagcactgttagaaagtggtgtgtacgaaggaaactac
tacgggactcccaaaccccctcctgtccctctctcccctccaattgtacgaagatcaaac
tccgctaatgaccttccagggatgcatccctcctctgatgggaagaggcggaggaacaga
tcaaatatcgaacaacagtcatcttcttccgggtctactccacgacgaaaccatgttttt
ccacccaacaataaagatggagataagaaaacattatctgtgaccaccaaggagtcttca
aatcctaatggagacttaacacctgctgaatctccgaagaaagaaacctcaatcccacac
gaccaacaaaattcggataaaattcttggcccgttacctgaaggttgggagatggggcaa
accgagaatggagattgttactttatagatcacatcgggaagaaaacttcgtgggttgat
cctcgcttggagaaaatgaacagaaagagtttgctcgactgtgaggatgatgaacttcct
tatggttgggaaaaagttgaagatgctcaattcggcctctactttgttgaccacatcgat
aagaaaacccagtttgagaatcctgtcatccaagccaagagggaagcagggaagtccatg
gagcatccggaccttccctctcctccacagagtgataatgaggaacaaaatggatcagaa
ttacatcctcagaagaatacaaatagtgacgattcctttcaagacaacatgagctcccaa
gaaaattatgttttcactcgtgacccctccaaattgaagggggtttcccacttagtcccc
atcgagaaaagtcggcgtgggttcgggttcactatagtggggggtgacgacccggaagaa
tttcttcaaattaaaagcgttgtttctgatggtgcagctgccaagagtggaaacattgaa
caaggtgacgtaattgtcaaagtaaacgacacttgtgttctgggatggactcatcctgac
gtagtgaagctttttcaagccattcccgtcggtcaaatagttacactacagctttgcagg
ggttacccactgataattgactcagatgacccaagcaccaacctcttaaccacgtatgct
attcgacctgaagataaaccaaccgaggaatttaatcgacagcttcggttgttgaacacg
caactggacgatggatctgaagtaatgggggatatgaatggtgaagcactgatgtcaagt
ccttccaaatcaatgcccaacatagctgatcatccaaatacttactatccaaactatgga
caacacaacataggaatgttaccacaatctactggcttccctacaagagctggcagcatg
ggagcgctccctgcacccctagtaatgcaggtgattataaaaaagggtgaacaagggttt
ggcttcacaatatctgacagtccacaaggccaacgtgtcaagcaagtacttgaggctcaa
cgctgtcatgaattaatggaaggtgacattctgcttgaaataaatggcaccacagttcaa
aacatgccacacaacaacgtcgtccatatcctgaaggattgccccagcaacgctgctgct
attttcgtcatacagcgaggacccctttccacccccatgtatgaccccgaagcactcatg
ggttaccaacctgggttcgctaacggggtttcccatcaccctcatgctttccagaaccac
aaccaagctataagggcaaggatgaagagatcaaccactgaaccaggacttgggagtgaa
aatggctccgttgtctccgcaccccccagcagttcacttgggccacctacatcccaacac
cctgttaatgcattgttatcggaatatagaaccaaacaccatcctgccaacataagacag
gacaattatggaataccagtgacttatcacccttatcggggccagaccatctaccatgac
ccatatgtagtgactccgcaaaccgacaactacatctacctcactgtagtcctcaggagg
gaggagacgggatttgggttccggattttaggaggaaacttccaagatgagagcgtaacg
atagggcagatagtcaaaagtggtgctgctgataaagaaggaacgttaagaacaggtgac
gaacttttaacagtggatggcaagaaagtgacaaggattggtcataaccaggttattgca
ttgatgggaaacgcggcacgtaacgcggttgtccaacttggtatccgacgcaaagaaaca
tgtacagctgctataaaccttccccatagtaggggtcctgtcatgaacccccgttcttcc
tctcgccccagcagtagggggccccctaacactccagtcaatgagggccaaccattcgac
attattattcaccgacgagagcatgagggtttcgggttcgtgattatttcttcggtaaaa
acttcaatcacagggttccaggctcctcataagattggtcgtattattgacggttcccca
gcagcacggtgtggacacttgcgcgtcggcgaccgaatcctcgctgtgaacaacgtggac
atcacccatttacaccatggacaaattgtcaacctcatcaaggattctggattctccata
gctttgcatgtccttcccattgaagcggacttggataactctaacaggggctcacagagc
gatagtgaatgtttctacgttgagttaccaagatcaaacaaaggttttgggtttggtatt
cgaggtgggaaagaatataacttgcctttgtatgtcctacgtgttgctaaagatggccca
gctgctgaatcgggtcaaataagggttggtgatatattaatggaaataaacgggaaaagt
acgatagacattcctcactcccaagcaatcaaccttataaagcagggaggatcagttgtg
aagcttctacttaaacatggtgatggaaatgtacctgaacttggaactcctggagcaaac
cctagtggcagcatgcagtccctctcctctagcgccctctctggctcagatgcggccaac
cgagcagcccaactcatgcacttttgccacccagaaaaggtggaacgtccaccaccttca
agccactcatcttcaaaaggcaaacccccacctacattgcccaaaccacaaacgcacaac
aactcagttcgacagcttcgccgacgtgcaaactcatcaggccaggtacttccacctgac
ccaaaccaaccacaatcaacccagcttcgtagatccatgacccccaacccagcaaaatca
cctcgagaacctatacccatttctcctaatagtgacgttgctgctcccacaccacaacct
gagctccaaaaagcagcaaactcccacccagaacaacatttctctaacacaaagtctcca
gaacctgttgaaaccaaccacggtccaccctcttctaacggcctcacttctcccacaaat
tccaagagcagtgaaaagctgagctccccggacaagtccacagacacagaaaccacatct
ccaacaagctccacaccaactgaagaaaacaagaaaaagtcaaaaaaatcaaccaaatcc
aacaaaaaatccagcaaagttggcctctggctttcacccaagaaaaaacagaagtag

DBGET integrated database retrieval system