KEGG   Ciona intestinalis (sea squirt): 778972
Entry
778972            CDS       T01056                                 

Gene name
jun
Definition
(RefSeq) transcription factor protein
  KO
K04448  transcription factor AP-1
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin04137  Mitophagy - animal
cin04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    778972 (jun)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    778972 (jun)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cin03000]
    778972 (jun)
Transcription factors [BR:cin03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    778972 (jun)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 ZapB
Other DBs
NCBI-GeneID: 778972
NCBI-ProteinID: NP_001071996
Ensembl: ENSCING00000009285
UniProt: Q4H3A1
Position
5
AA seq 381 aa
MEVTFYHDDPASRITYDLHSSPGSVESASSTDGGPVSAISTVPPPYSRHQYDHEFNKTAV
LKGMSLNLSDNYSRQSLGKANSAITSSAISSTGYHQPNVVTNSYEQIQSSIVPASSSSLS
VSIPEHGSLNAATLSTPDLVNMLKVGSPDFDRMLVHSSQANTQNNSQFFQRNATQEQEIY
AQGFVRELERLKSHGSNPDLAAASPHSAGSSTTETPQPSVITSGVMSHQHYAPESYYTRE
QLHDIPTTSGLGGTVHHVGNPIHLAQQPPMAYMPHLKEESPQTVPIGSSPPVSPINMDHQ
ELIKSERKRLRNRVAASKCRKRKLERISRLEDKVNNLKNQNLELTSSANLLRQQVAELKS
KVMTHVNSGCQLMMSQQQVTF
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggaagtaacgttttaccacgacgatccggccagcagaatcacatacgacctgcattcg
tcccccggctcagtagagagcgctagtagtacagacggtggaccagtttcagctatatct
actgtaccaccaccatacagcagacaccagtacgatcacgagtttaacaaaacagccgtc
ttgaagggtatgagcttaaacctcagtgataattactcgagacagtcgctagggaaggcg
aactcggcgataacgtcaagtgcaatttcgtcgaccggataccatcaaccaaacgtagta
acgaactcatacgaacagatccagtcttcgattgtaccagcaagttcaagtagcctgagt
gtcagcatcccagagcacggctcgcttaacgctgctactttatccactcccgatctggtg
aatatgctcaaagtaggatcgccggattttgatagaatgctcgtacatagcagtcaagcg
aacactcagaataactctcagtttttccaaagaaacgccactcaggagcaagaaatttac
gcccaaggttttgtccgcgaattggaaaggctcaagtcacacggcagtaatccagacctc
gccgccgccagtccgcattctgcgggaagttcgaccactgaaaccccgcagccgtccgta
ataacctcgggcgtgatgtcgcatcaacactacgcaccagaatcgtactatacaagggaa
caactccatgatatacctactaccagtggattaggtggtaccgtacaccatgtcggtaac
ccaattcaccttgcccaacagccaccaatggcgtacatgccccacttaaaagaggagtca
ccccagaccgtcccaataggcagcagtcccccagtttccccgataaacatggaccaccaa
gaacttataaaatcggaacgaaaacgattaagaaaccgagttgctgccagcaaatgcaga
aagcggaaactggaacgtatttccaggctcgaggacaaagtgaacaatcttaagaaccaa
aaccttgaactgacgagcagtgcaaacctgcttagacagcaagttgcagaactcaaatct
aaagtaatgacgcatgtcaactcgggatgccagcttatgatgtcccaacagcaggtcacc
ttttga

DBGET integrated database retrieval system