KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394189Help
Entry
100394189         CDS       T03264                                 

Gene name
CDKN2A
Definition
(RefSeq) cyclin dependent kinase inhibitor 2A
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04110  Cell cycle
cjc04115  p53 signaling pathway
cjc04218  Cellular senescence
cjc04934  Cushing syndrome
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05206  MicroRNAs in cancer
cjc05212  Pancreatic cancer
cjc05214  Glioma
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05223  Non-small cell lung cancer
cjc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100394189 (CDKN2A)
   04115 p53 signaling pathway
    100394189 (CDKN2A)
   04218 Cellular senescence
    100394189 (CDKN2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100394189 (CDKN2A)
   05206 MicroRNAs in cancer
    100394189 (CDKN2A)
   05203 Viral carcinogenesis
    100394189 (CDKN2A)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100394189 (CDKN2A)
   05225 Hepatocellular carcinoma
    100394189 (CDKN2A)
   05214 Glioma
    100394189 (CDKN2A)
   05220 Chronic myeloid leukemia
    100394189 (CDKN2A)
   05218 Melanoma
    100394189 (CDKN2A)
   05219 Bladder cancer
    100394189 (CDKN2A)
   05223 Non-small cell lung cancer
    100394189 (CDKN2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100394189 (CDKN2A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100394189 (CDKN2A)
   05163 Human cytomegalovirus infection
    100394189 (CDKN2A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100394189 (CDKN2A)
   01522 Endocrine resistance
    100394189 (CDKN2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank
Motif
Other DBs
NCBI-GeneID: 100394189
NCBI-ProteinID: XP_008996005
Ensembl: ENSCJAG00000008048
UniProt: F7I223
Position
1
AA seq 148 aa AA seqDB search
MEPSADWLATAAARGRVEEVRALLEAGAPPNAPNSYGRRPIQVMMMGSARVAELLLLHGA
EPNCADPATLTRPVHDAAREGFLDTLVALHRAGARLDVRDAWGRLPVDLAEERGHCHVAG
YLRAAAGGTTGSSPTRTDAAGGPSDVPD
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggaaccttccgcggactggctggccacggccgcggcccggggtcgggtagaggaggtg
cgggcgctgctcgaggcgggggcgccgcccaacgcaccgaatagttacggtcggaggccg
atccaggtcatgatgatgggcagtgcccgcgtggcagagctgctgctgcttcacggcgcg
gagcccaactgcgcggaccccgccactctcacccgaccagttcacgacgctgcccgggag
ggcttcctggacacgctggtggcgctgcaccgggccggggcgcggctggacgtgcgcgat
gcctggggccgtctgcccgtggacctggctgaggagcggggccactgccacgttgcaggg
tacctgcgcgcggctgcggggggcaccacaggcagtagccctacccgcacagatgccgcg
ggaggtccctcagacgtccccgattga

DBGET integrated database retrieval system