KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398171
Entry
100398171         CDS       T03264                                 
Symbol
PCGF1
Name
(RefSeq) polycomb group ring finger 1
  KO
K11487  polycomb group RING finger protein 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100398171 (PCGF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100398171 (PCGF1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     100398171 (PCGF1)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 Rad60-SLD zf-RING_UBOX ATG8 zf-Nse Cobl zf-ANAPC11 zf-C3HC4_4 zf-RING_10
Other DBs
NCBI-GeneID: 100398171
NCBI-ProteinID: XP_002757636
Ensembl: ENSCJAG00000017432
UniProt: F7GL18
Position
14:32333514..32335900
AA seq 259 aa
MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTI
TECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEE
KRIREFYQSRGLDRVTQPSGEEPALSNLGLPFSSFDHSKAHYYRYDEQLSLCLERLSSGK
DKNKSILQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSR
WFGKPSPLVLQYSVKEKRR
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcgtctcctcaggggggccagattgcgatcgcgatgaggcttcggaaccagctccag
tcagtgtacaagatggacccgctacggaacgaggaggaggttcgagtgaagatcaaagac
ttgaatgaacacatcgtttgctgcctatgtgccggctacttcgtggatgccaccactatt
acagagtgtcttcatactttctgcaagagttgtattgtgaagtaccttcaaactagcaag
tactgccccatgtgcaacatcaagatccatgagacacagccactgctcaacctcaaactg
gaccgggtcatgcaagacatcgtgtacaagctggtgcctggtttgcaagacagtgaagag
aaacggattcgggaattctaccagtctcgaggtttggaccgggtcacccagcccagtggg
gaagagccagcactgagcaaccttggcctccccttcagcagcttcgaccactctaaagcc
cactactatcgctatgatgagcagctgagcctgtgcctggagcgactgagttctggcaaa
gacaagaataaaagcatcctgcagaacaagtatgtccgatgttctgttagagctgaggta
cgccatctccggagggtcctgtgtcaccgcttgatgctaaaccctcagcatgtgcagctc
ctttttgacaatgaagttctccctgatcacatgacaatgaagcagatatggctctcccgc
tggttcggcaagccttcccctttggttttacaatacagtgtgaaagagaagaggaggtag

DBGET integrated database retrieval system