KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398664
Entry
100398664         CDS       T03264                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100398664 (AHRR)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100398664 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_4 PAS_9
Other DBs
NCBI-GeneID: 100398664
NCBI-ProteinID: XP_017821212
Ensembl: ENSCJAG00000017613
Position
2
AA seq 777 aa
MFVSAQLPYCMEKSRFCDKKGDALSEVNDRPRTMIPPGECTYAGRKRRRPLQKRRRNSAR
EAGGGGGGRAVGRGGFPGSAGETATCWDGGRPALGVEKSNPSKRHRDRLNAELDHLASLL
PFPPDIISKLDKLSVLRLSVSYLRVKSFFQAVQEQGSRQPVAGTPSPEDSHPPAGSAVLE
GRLLLESLNGFALVVSAEGKIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFRRQL
HWAMDPPQVVSGQPPPSETGDDAVLGRLLRAQEWGAGVPIEYSAFLTRCFVCRVRCLLNS
TSGFLTMQFQGKLKFLFGQKKKAPSGAVLPPRLSLFCVVAPVLLPSATEMKMRSALLRAK
PRADSAAPTDAKVKATMSLCKSEQHGKPNYSAGRSSRESGILVLREQTDTGQWAQVPARA
PCLCLRGSPDLVLKPKRTSRDREEQQQRVLSRASGASGRRETPGPTKPLPWMAGRRSEDG
ARPKVQPNQSGLLSLRPTSHGSCLPYPCVQGTFNASSSGTFRNLPISQPPSPPPSAHAIR
TSRASWDVCEDQVHPPLCHFPQGSLQHPQPETQHLASRGYTTEDGKLRGVQMPPRGLCSP
TLLLDVPIKMEKDSGSEDAAHGCMPSQVWGLGAGDRSRLVTFPTRMPLKTEPDSLHQVYT
AHLGHGVLGAQPQGRATMGRSRELATFHPAHCARLEPTHSLPQLEPPHQLCARGRGELSS
LPSCTCRAAETAPVVKREPLDSPPWATYSQGRAPGMFPKSALATLVPPQASECTFLP
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgtttgtgagtgctcagctgccctattgcatggaaaaatcaagattctgtgacaagaag
ggtgatgccctctctgaggtgaatgacaggccgaggacgatgatcccgccgggggagtgc
acgtacgccggccgcaagcggaggaggcccctgcagaaacgacgtaggaacagcgcgcgc
gaggcgggcggcgggggcgggggccgggccgtgggccgtggcggcttcccaggctctgca
ggcgagaccgccacctgctgggacggagggaggcctgccttgggggtggagaagtccaac
ccctccaagcggcaccgggaccgcctcaacgctgagttggaccacctggccagcctgctg
cccttcccacctgacatcatctccaagctggacaagctttctgtcttgcgcctcagtgtc
agttacctccgggtgaagagcttcttccaagctgtgcaggagcagggctcacggcagccg
gtggccggcaccccctctcccgaagacagccatcctcctgcggggtctgcggtgctggag
ggaaggctgctgctggagtctcttaatggctttgctctggtcgtgagtgctgaagggaag
atattttacgcatcagcaacgatcgtggactatctgggcttccaccagacggacgtaatg
caccagaacatttacgactacatccatgtggacgaccgccaggacttccgccggcagctg
cactgggccatggaccctccccaggtggtgtctgggcagcccccgccctcggagacagga
gatgacgccgtcctggggaggctgctcagggcccaggagtggggcgcaggcgtgcccatc
gagtactcggccttcctgacccgctgcttcgtctgccgtgtgcgctgcctgctaaacagc
acctcaggcttcctgacgatgcagtttcaagggaaactaaaattcctgtttggacagaag
aagaaggcgccctcaggggcggtgctcccaccgcggctgtcgctgttctgcgttgtggca
ccggttctccttccctccgcaactgagatgaaaatgaggagtgcgcttctgagggccaag
cccagggctgactctgcggcgcccacggatgcaaaagtaaaggccaccatgagtctgtgc
aaatcggaacagcatggaaaacccaattactcagcaggaaggagcagcagagaaagcggc
attttggtgctcagggaacagactgacactggccaatgggcacaggttcccgccagagcc
ccatgcctctgcctccggggcagccctgaccttgtcctcaaacccaagcggacctcaagg
gacagggaggagcagcagcagagggtgctgagcagggcctctggagcttcagggcggagg
gagacaccgggacccacaaagcccctgccctggatggcaggaaggcgcagtgaggatggt
gcccggccgaaggtgcagcccaaccagagtggcctactctccctgcgccccacgtcccat
ggctcctgcctgccctacccatgtgtccagggcactttcaatgccagtagctcgggcaca
ttcaggaacttgcccatctctcagccgccaagcccaccccccagtgcccacgccatccgg
accagcagagcctcgtgggatgtctgtgaggaccaggtgcaccctcctctctgccacttt
ccccaggggagcctgcagcaccctcagcctgaaactcagcatttggcctcaaggggctac
accacagaggacgggaagctgcgaggcgtgcagatgcctccaaggggcctgtgcagcccg
acgctgctgttagatgtgcccatcaagatggagaaggactctgggtctgaggatgctgcc
catggctgcatgcccagccaggtgtgggggctgggggctggggacaggagccgtctggtc
accttccctaccaggatgcccctgaagacagagccagactccctgcaccaggtctacact
gcacacctcgggcatggcgtgttgggggctcagccccaaggcagggccactatggggcgc
agcagggagctggccactttccaccctgcacactgtgcacgcctggaacccacacacagc
cttccccagctggagcctccccaccagctctgcgcacggggccgaggtgaactctcctcc
ctgccaagctgcacctgcagagctgctgagaccgcccctgtggtcaagcgcgagccactg
gactcgcccccgtgggccacttacagccagggaagggcgcctgggatgtttcccaaaagt
gccttggcgacgctggtcccaccccaagcctcagagtgcacattcctgccgtag

DBGET integrated database retrieval system