KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400461
Entry
100400461         CDS       T03264                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100400461 (ANKRD53)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100400461 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3
Other DBs
NCBI-GeneID: 100400461
NCBI-ProteinID: XP_003734769
Ensembl: ENSCJAG00000019374
Position
14
AA seq 536 aa
MSSAGSSSRRAGSGSWHSERGEGRGARPQPAPRGSMQRENKASLKATWPDEESKQPSPPP
AGLADSLRAQAIAVATTPSPRPASLXPPCADPSPSEESDQTAIHQLAIHQMAIRNYYQLI
AAAVGNVEWLRFCLNQSLGEIPTTNKGFTAIHFAAQRGKFTCLQVLVEEYKFPVDLLTKD
SQTPLHLVIHRDNTSVALPCIYYLLEKGAALNVQTCNGSTPLHLAAREGLLDCMKVLVQS
GANVHAQDAMGYKPIDFCKIWNHRACARFLKDAMWKKDKKDFAREMEKMKTVKSQLAVME
HNYLIEYQKEHKILREAAIRKWLHGKLHPGHSLVSNTKQARATALSKTPEQRRLQCSRSF
HPSVKVRLQCMPQPTEMPKPIYRNPTVKRPMWNVSNNPARSPITQISHPQGIRLGVHPDP
SPEHDFSSFLEVTPDRHGGARLHTVDGHWVAPVPRLPFEVMLRTLCPRVWPYRMKVPQGF
YPISMREVPRKRHLGDDNFWTDTLTMNLRDTFDEAFLAAVRSHQGLPALPCLQTHP
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgtcctccgcgggcagcagttctcggcgggcgggctcgggaagctggcactcagaaagg
ggagaagggagaggggctcggccgcagccagctccacgtggctccatgcagcgggagaac
aaagcctccttgaaggccacctggcctgacgaagagtccaagcagcccagcccgccccct
gcgggcctcgccgacagccttcgagcacaggctattgccgtcgccacgaccccctccccc
cgccctgcctcgctcnacccgccctgcgctgaccccagtcccagcgaggagtccgaccag
acagcgatccaccagttggcgatccaccagatggcgatccggaactactatcagctgatc
gcggctgctgtgggcaacgtagaatggctgcggttctgtctgaaccagagcctcggggaa
atccccaccaccaacaagggcttcactgccatccactttgcagcccaacggggcaagttt
acatgcctgcaggtcctggtagaggagtacaagtttcccgtggacctgctgaccaaagat
agccagacccccctgcacctcgtcatccacagagacaacactagtgtggccctcccctgc
atctactacctgctggagaaaggggcagccctcaatgttcagacctgcaatggctccacg
cccctgcacctggcagcccgtgagggcctgctagactgtatgaaggtcctggtgcagagt
ggtgccaatgtccatgcccaagatgctatgggctacaaacccattgacttctgcaaaata
tggaaccaccgtgcctgtgcccggttcttgaaggatgccatgtggaaaaaggacaagaag
gattttgcccgtgagatggagaaaatgaagacagtcaagagccagctggctgtcatggag
cacaactacctgattgagtatcaaaaagagcacaaaattctcagagaagctgctatcaga
aagtggctccacggcaagctgcacccaggccactctctggtctctaacaccaagcaagcc
cgggccactgccctctccaagactccagagcaacggagattgcagtgttccaggagcttc
cacccctctgtgaaggtgcgcctgcaatgcatgccacagcccacggagatgcccaagccc
atctataggaaccccacagtcaagaggccgatgtggaatgttagcaacaaccctgccaga
tcccccatcacccagatcagccatccacagggcatccgcctgggcgtgcatccagacccc
agcccggagcacgatttcagcagcttcctggaggtgacacctgacaggcacggaggtgcg
cggctgcacacagtggatggccactgggtggcgcccgtgccacggctgccttttgaagtg
atgctccgcacgctatgtccacgtgtgtggccttacagaatgaaggtgccccagggtttt
taccccatcagcatgagggaagtgccccggaagaggcacctgggtgatgacaacttctgg
accgacactctgaccatgaacctgcgtgacacatttgatgaagccttcctggcagctgtg
cgatctcatcaaggactccccgccctgccctgcctgcaaacccacccataa

DBGET integrated database retrieval system