KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403902
Entry
100403902         CDS       T03264                                 
Symbol
COL9A3
Name
(RefSeq) collagen type IX alpha 3 chain
  KO
K08131  collagen type IX alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04974  Protein digestion and absorption
cjc05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100403902 (COL9A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100403902 (COL9A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100403902 (COL9A3)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    100403902 (COL9A3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100403902 (COL9A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:cjc00535]
    100403902 (COL9A3)
Proteoglycans [BR:cjc00535]
 Extracellular matrix (ECM) proteoglycans
  Others
   100403902 (COL9A3)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 100403902
NCBI-ProteinID: XP_017827163
Ensembl: ENSCJAG00000009909
Position
5:56842331..56870565
AA seq 701 aa
MAQAPALAPLLPRLLPSFLLLLTQLLAAAGAQKVGLPGPPGPQGPPGKPGQDGIDGEAGP
PGLPGPPGPKGAPGKLGKPGEAGLPGLPGVDGLTGRDGPPGPKGAPGERGSLGPPGPPGL
GGKGLPGPPGEAGVSGSPGGIGLRGPPGPSGLPGLPGPPGLPGPPGHPGVLPEGAADLQC
PSICPPGPPGPPGMPGFKGPTGYKGEQGEVGKDGEKGDPGPPGPAGLPGSVGLQGPRGLR
GLPGPLGPPGDRGPIGFRGPPGIPGVPGKAGDRGERGPEGFRGPKGDLGRPGPKGTPGVA
GPSGEPGMPGKDGRNGVPGLDGQKGEAGRNGAPGEKGPNGLPGLPGRAGSKGEKGERGRA
GELGEAGPSGEPGVPGDAGMPGERGEAGHRGSAGALGPQGPPGAPGVRGFQGRKGSMGDP
GLPGPQGLRGDMGDRGPGGAAGPKGDQGIAGSDGLPGCIKENRVAPPAETTPSGPSGLVG
PKGESGSRGELGPKGIQGPNGTSGVEGVPGPPGPLGLQGIPGVPGITGKPGVPGKEASEQ
RIRELCGGMISEQIAQLAAHLRKPLAPGSIGRPGPAGPPGPPGPPGSIGHPGARGPPGYR
GPTGELGDPGPRGNQGDRGDKGAAGAGLDGPDGDQGPQGPQGVPGSSKDGQDGAPGEPGP
PGDPGLPGTIGAQGTPGICDTSACQGAVMGGVREKSGSRSS
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggcccaggcgcccgcgctcgccccgctcctgccccggctcctgccctcgttcctgctc
ctgctcacgcagctcctggcggccgctggggcacagaaagtgggactcccaggccccccc
ggcccccaagggccacccggaaagcccggccaggatggcatcgatggagaagctggtcct
ccgggtctgcctgggcccccaggaccaaagggggccccaggaaagctggggaaaccagga
gaggctgggctgccgggactgccgggtgttgatggtctcactgggagagatggaccccct
ggacccaagggtgcccctggggaacggggaagtctgggacccccggggccacccgggctg
gggggcaaaggccttcctggaccccctggagaggcaggagtgagcggctccccaggtggg
atcggcctccgaggccccccgggaccttctgggctccctggccttcctggccccccagga
cttcccggaccccctggacacccaggagtcctccctgaaggcgctgctgacctccagtgc
ccaagtatctgcccgccaggtcccccagggcccccaggaatgccagggttcaagggaccc
actggctataaaggcgagcaaggggaagtaggcaaggacggcgagaagggtgaccctggc
ccccctgggcctgccggcctcccgggcagcgtggggctgcagggcccccggggattacga
ggactgccagggccactcgggccccctggggaccggggtcccatcgggttccgagggccg
cctgggatcccaggagtgcccgggaaggcgggtgatcgaggcgagaggggcccagaaggg
ttccgtggccccaagggtgacctcggcagacctggtcccaagggaacccccggagtagcc
gggccaagtggagagccgggcatgccaggcaaggatggccggaatggcgtgccaggactt
gatggccagaagggagaggctggtcgcaatggtgctccgggagagaagggccccaacggg
ttgccaggcctccccggacgagcaggctccaaaggcgagaagggagaacggggcagagct
ggggagctgggtgaggccggcccctcgggagagccaggtgtccctggagacgctggcatg
cctggggaacgcggtgaggctggccacaggggctcagcgggggcccttggcccacaaggc
cctcccggagcccctggtgtccgaggcttccagggccggaagggcagcatgggagaccct
ggccttccaggcccccagggcctccggggtgacatgggtgaccggggtcctggaggcgct
gcaggacctaagggagaccagggcattgcaggttccgacggtcttcctgggtgtataaag
gagaaccgagtggcaccacctgcagaaaccaccccatctggtcctagcggcctggtcgga
cccaaaggagagtctggcagtcgaggggagctgggccccaaaggcatccagggtcccaac
ggcaccagcggtgttgagggtgtccctggcccccctggtcctctgggcctccagggcatc
ccaggtgttcctggcatcacagggaagccgggcgttccggggaaggaggccagtgagcag
cgcatcagggagctgtgtggggggatgatcagcgaacaaattgcacagttagccgcgcac
ctaaggaagcctttggcaccggggtccattggccggcccggtccagctgggccccctggg
cccccagggcctccgggctcgattggtcaccctggcgctcgaggaccccccggataccgc
ggtcccactggggagctgggagaccccgggcccagaggaaaccagggtgacagaggggac
aaaggcgcagcgggagcaggactggacggacctgacggagaccaggggccccaaggaccc
caaggcgtgcccggcagcagcaaggacggccaggacggtgctcctggtgagcctgggcct
cctggggatccggggcttccaggcaccatcggagcccaggggactccggggatctgtgac
acctcagcctgccaaggagccgtgatgggaggggtcagggaaaaatctggctctagaagc
tcataa

DBGET integrated database retrieval system