KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404947
Entry
100404947         CDS       T03264                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cjc01002]
    100404947 (ADAMTS13)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100404947 (ADAMTS13)
Peptidases and inhibitors [BR:cjc01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100404947 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 TSP1_CCN Reprolysin Reprolysin_4 Reprolysin_3 TSP1_spondin Reprolysin_5 Peptidase_M10 Reprolysin_2
Other DBs
NCBI-GeneID: 100404947
NCBI-ProteinID: XP_017818689
Ensembl: ENSCJAG00000009791
Position
1
AA seq 1379 aa
MRQRHPWARCPPFCVAGILACGFLLGYWGPSHFQQSCLQTLEPETVSSYLSPGAPLKGHL
PLLGFQRQRQRRAAGSILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSLGV
QFRVHLVKMVILTEPECGWSQTINPKDDMDPGHADLVLYITRFDLELPDGNRQVRGVTQL
GGACSSTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDGAPGSGCGPSGHVMASDGAAPRA
GLAWSPCSRQQLLSLLSANEQCRVAFGPKAVACTFARDHLDMCQALSCHTDPLDQSSCSR
LLVPLLDGTECGVEKWCSKGRCRSLMELTPIAAVNGHWSSWGPPSPCSRSCGGGVVTRRR
QCSNPRPAFGGRVCVGADLQAEMCNTQACEKTQLEFMSEQCARTDGQPLPSSPGGTSFHH
WGAAVPHSQGDALCRHMCRAIGESFIMKRGDSFLDGTRCVPSGPREDGTLSLCVSGSCRT
FGCDGRMDSQQVWDVCHVCGGDNSTCSPRKGSFTAGKAGEYVTFLTVTPNLTSVYVANHR
PLFTHLAVRIGARYVVAGKSSISPSTTYPSLLEDGRVEYRVTLTEDRLPRLEEIRIWGPL
QEDAEIQVYRRYGEEYGSLTRPDVTFTYFQPKPRQAWAWAAVRGPCSVSCGAGLRWVNYS
CLDQARKERVETARCRGSRQPPAWPEACVLEPCPPYWAVGDFGPCSASCGGGLRERSVRC
VEAHGSLLKMLPPAWCRAGAQQPAVAETCNPQPCPARWEVSEPSPRTFAHGAGLALQNET
YVPGADGLEAPVTVGPSSIDEKLPAPEPCTGMSCPPAWGHLDAISAGEEAPSPWGSTRTW
TGAAPVWTPVAGLCSVSCGRGLMELRFLCMDSALRVPAQEELCGLANKPGSRWEVCQAVP
CPARWRYKLAACSVSCGGGVVQRILYCARAHGEDDDEEILLDTQCQGLPRPEPQEACSLE
PCPPRWKVMSLGPCSASCGLGTARRLVACVQLDQAQDVEVDEAACAALVRPQASVPCLSA
DCTYHWHVEAWTECSVSCGDGIQRRRDTCLGPQAQEPVPTDLCQHLPKPVTVRGCWAGPC
AGQGMPSLAPHEEATAPGQTTATPAGASLEWSQAQALPFSPAPQPWRLLPGRQESPAQSS
ACGRQLLEPTGTIDMRGPGQADCAVAIGRPLGEVVTLRVLESSLNCSAGEMLLLWGRLTW
RKMCRKLLGMTFSSKTNTLVVRQRCGWSGGGVLLRYGSQPAPETFYRECDMQLFGPWGEI
VSPSLSPATRNAGSCRLFIDVAPHARIAIRALATDVGTGTEGANDSYISIRDIHSLRTTT
FRGQQVLYWESESSQAEMEFSEAFLKAKASLRGQYWTLQSWVPEQDPQSWKGKEEPDGR
NT seq 4140 nt   +upstreamnt  +downstreamnt
atgcgccagcgtcacccctgggcaagatgccctcccttctgtgtggccggaatccttgcc
tgtggctttctcctgggctactggggaccctcgcatttccagcagagttgtcttcagact
ttggagccagagactgtgtcctcttacttgagccctggtgctcccttaaaaggccacctt
cctttactcggcttccagaggcagaggcagaggcgggctgcaggcagcatcctacacctg
gagctgctggtggccgtgggccccgatgtcttccaggctcaccaggaggacacagagcgc
tatgtgctcaccaacctcaacatcggggcagaactgctgcgggacccatccctgggggtt
cagttccgagtacacctggtgaagatggtcattctgaccgaacctgagtgtgggtggagc
cagaccatcaaccccaaggacgacatggatcctggtcatgctgacctggtcctctatatc
accaggtttgacctggagttgcctgatggtaaccggcaggtgcggggggtcacccagctg
ggcggtgcctgctcctcaacctggagctgccttattactgaggacaccggcttcgacttg
ggagtcaccattgcccatgagattgggcacagcttcggcctggagcacgacggcgcaccc
ggcagcggctgcggccccagcggacacgtgatggcttcagacggcgccgcgccccgcgcc
ggcctcgcctggtccccttgcagccgccagcagctgctgagcctgctcagtgccaacgag
cagtgccgcgtggcctttggccccaaggctgtcgcctgcacctttgccagggaccacctg
gatatgtgccaggccctctcctgccacacagacccgttggaccaaagcagctgcagccgc
ctcctcgtccctctcctggatgggacagaatgtggtgtggagaagtggtgctccaagggc
cgctgccgctccctgatggagctgacccccatagcagcggtgaatgggcactggtctagc
tggggtcccccaagtccttgctcccgatcctgcggaggaggtgtggtcaccaggaggcgg
cagtgcagcaaccccagacctgcctttggggggcgtgtgtgtgttggtgctgacctccag
gccgagatgtgcaacactcaggcctgtgagaagacccagctggagttcatgtcggaacag
tgcgccaggacagatggccagccgctgccctcctcccctggcggcacctccttccaccac
tggggcgctgctgtgccacacagccaaggggatgctctatgcagacacatgtgccgggcc
attggcgagagcttcatcatgaagcgtggagacagcttcctggatgggacccggtgtgtg
ccaagtggcccccgggaggatgggaccctgagcctgtgtgtgtcgggcagctgcaggacc
tttggctgtgatggcaggatggactcccagcaggtatgggacgtgtgccacgtgtgtggt
ggggacaacagcacgtgcagcccccggaagggctctttcacagctggaaaagctggagaa
tatgtcacatttctgacggttacccccaacctgaccagtgtctatgttgccaaccacagg
cctctcttcacacacttggcggtgaggattggagcacgctacgtggtggctgggaagtcg
agcatctcccctagcaccacctacccctccctcctggaggatggccgtgtcgagtacaga
gtgacccttactgaagaccggttgccccgcctggaggagatccgcatctggggacccctg
caggaagacgctgagatccaggtttataggcggtacggcgaggagtatggcagcctcacc
cgcccagatgtcaccttcacctatttccagcctaagccacggcaggcctgggcgtgggcc
gctgtgcgcgggccctgctcggtgagctgtggggcagggctgcgctgggtaaactacagc
tgcctggaccaggccaggaaggagcgggtggagactgcccggtgccgagggagccggcag
ccaccagcgtggccagaggcctgcgtgctcgaaccctgccctccgtactgggcggtggga
gacttcggcccgtgtagcgcctcctgtgggggtggcctgcgggagcggtcagtgcgctgc
gtggaggcccatggcagcctcctgaagatgttgcccccagcctggtgccgagcaggggcc
cagcagccagctgtggcagaaacctgcaaccctcagccctgccctgccaggtgggaggtg
tcagagcccagcccacgcacatttgcccatggagcaggcctggccttgcagaacgagacc
tatgtgccaggggcagatggcctagaggctccagtgactgttgggcccagctccatagac
gagaagctgcctgctcctgagccctgtaccgggatgtcatgccctccagcctggggccat
ctggatgccatctctgcaggggaggaggctccctccccatggggcagtactaggacgtgg
actggagctgcacctgtatggacccctgtggcggggctgtgctccgtctcctgcgggcga
ggcctgatggagttgcgtttcctgtgcatggactctgccctcagggtgcctgcccaggag
gagctgtgtggcctggcaaacaagcccgggagccggtgggaggtctgccaggctgtcccg
tgccctgctcgatggcggtacaagctggcggcctgcagcgtgagctgtgggggaggggtc
gtgcagaggatcctgtattgtgcccgggcccatggggaggacgatgatgaggagatcctg
ttggacacccagtgccaggggctgcctcgcccagaaccccaggaggcctgcagcctggag
ccctgcccacctaggtggaaagtcatgtcccttggcccatgctcagccagctgtggcctt
ggcactgctagacgcttggtggcctgtgtgcagctcgaccaagcccaggacgtggaggtg
gacgaggcggcctgtgcggctctggtgcggccgcaggccagcgtcccctgtctcagtgct
gattgtacctaccactggcatgttgaagcctggacggagtgctctgtttcctgtggggat
ggcatccagcgccggcgtgacacctgcctgggaccccaggcccaggagcctgtgcccaca
gacctctgccagcacttgcccaagccggtgaccgtgcgtggctgctgggctgggccctgt
gcgggacaggggatgcccagcctggcaccccacgaagaagccactgctccaggacagacc
acagccacccctgctggtgcttccctggagtggtcccaggcccaggccctgcccttctcc
ccagctccccagccttggcggctcctgcctgggcgccaggaaagcccagcgcagtccagt
gcctgtggcaggcaactccttgagccgacaggaaccattgacatgcgaggcccagggcag
gcagactgtgcagtggccattgggcggccccttggggaggtggtgaccctccgtgtcctt
gagagctctctcaactgcagcgcgggggagatgttgctgctttggggccggctcacctgg
aggaagatgtgcaggaagctgttgggcatgacattcagctctaagaccaacacgctggtg
gtgaggcagcgctgcgggtggtcgggaggcggcgtgctgctgcggtacgggagccagcct
gccccggaaactttctacagagaatgtgacatgcagctctttgggccttggggtgaaatt
gtgagcccctcactgagtccagccacaaggaatgcagggagctgccggctcttcattgat
gtggctccgcacgcccggattgccatccgtgccctggccactgatgtgggcactgggacc
gagggagccaatgacagctacatctcgatccgggacatccacagcttgaggaccacaaca
ttccgtgggcagcaggtgctttactgggagtcagagagcagtcaggctgagatggagttc
agcgaggccttcctgaaggcaaaggccagcctgcggggccagtactggaccctccaatca
tgggtgccagagcaggaccctcagtcctggaagggaaaggaagaacctgacggtcgttga

DBGET integrated database retrieval system