KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407754Help
Entry
100407754         CDS       T03264                                 

Gene name
MYC, CMyc
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog
  KO
K04377  Myc proto-oncogene protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04110  Cell cycle
cjc04151  PI3K-Akt signaling pathway
cjc04218  Cellular senescence
cjc04310  Wnt signaling pathway
cjc04350  TGF-beta signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04630  Jak-STAT signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05213  Endometrial cancer
cjc05216  Thyroid cancer
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100407754 (MYC)
   04012 ErbB signaling pathway
    100407754 (MYC)
   04310 Wnt signaling pathway
    100407754 (MYC)
   04350 TGF-beta signaling pathway
    100407754 (MYC)
   04390 Hippo signaling pathway
    100407754 (MYC)
   04630 Jak-STAT signaling pathway
    100407754 (MYC)
   04151 PI3K-Akt signaling pathway
    100407754 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100407754 (MYC)
   04218 Cellular senescence
    100407754 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100407754 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100407754 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100407754 (MYC)
   05202 Transcriptional misregulation in cancer
    100407754 (MYC)
   05206 MicroRNAs in cancer
    100407754 (MYC)
   05205 Proteoglycans in cancer
    100407754 (MYC)
   05230 Central carbon metabolism in cancer
    100407754 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100407754 (MYC)
   05225 Hepatocellular carcinoma
    100407754 (MYC)
   05226 Gastric cancer
    100407754 (MYC)
   05216 Thyroid cancer
    100407754 (MYC)
   05221 Acute myeloid leukemia
    100407754 (MYC)
   05220 Chronic myeloid leukemia
    100407754 (MYC)
   05219 Bladder cancer
    100407754 (MYC)
   05213 Endometrial cancer
    100407754 (MYC)
   05224 Breast cancer
    100407754 (MYC)
   05222 Small cell lung cancer
    100407754 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100407754 (MYC)
   05161 Hepatitis B
    100407754 (MYC)
   05160 Hepatitis C
    100407754 (MYC)
   05163 Human cytomegalovirus infection
    100407754 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100407754 (MYC)
   05169 Epstein-Barr virus infection
    100407754 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100407754 (MYC)
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100407754 (MYC)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    100407754 (MYC)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100407754 (MYC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Motif
Other DBs
NCBI-GeneID: 100407754
NCBI-ProteinID: XP_008981519
UniProt: P49032
Position
16
AA seq 438 aa AA seqDB search
MPLNVSFSNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSTSCVSVTPFSPRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSSSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKPCASPDSSAFSTSSDSLLSSTESSPRASPEPLVL
HEETPPTTSSDSEEEQEDEEIDVVSVEKRQPPGKRSESGSPSSGGHSKPPHSPLVLKRCH
VSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENDKRRTHNV
LERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATTYILSVQAEEQKLISEKDLLR
KRREQLKHKLEQLRNSCA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcagcaacaggaactatgacctcgactacgactcggtgcag
ccgtatttctactgcgacgaggaagagaacttctaccagcagcagcagcagagcgagctg
cagccgccagcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgcct
ctgtccccgagccgccgctcggggctctgctcgacctcctgcgtttcagtcacgcccttc
tcccctcgtggagacaacgacggcggtggcgggagcttctccactgccgaccagctggag
atggtgactgagctgctgggaggagacatggtgaaccagagcttcatctgcgacccggac
gacgagaccttcatcaaaaacatcatcatccaggactgtatgtggagcggcttttcggcc
gccgccaagctcgtctcagagaagctggcctcctaccaggctgcgcgcaaagacagcagc
agcccgaaccccgcccgcgggcacagcgtctgctccacctccagcttgtacctgcaggat
ctgagcgccgccgcctcggagtgcatcgacccctcggtggtattcccgtacccgctcaat
gacagcagctcgcccaagccctgcgcctcgccagactccagcgccttctccacgtcctcg
gactctctgctctcctcgacggagtcctccccgcgggccagccccgagcccctggtgctc
catgaagagacaccgcccactaccagcagcgactctgaggaggaacaagaggatgaagaa
atcgatgtcgtttctgtggaaaagaggcagcctcctggcaaaaggtcagagtcaggatca
ccctcttctggaggccacagcaaacctcctcacagcccactggtcctcaagaggtgccac
gtctccacacatcagcacaattacgcagcccctccctccacgcggaaggactacccagct
gccaagagggtcaagttggacagtgtcagagtcctgaggcagatcagcaacaaccgaaaa
tgcaccagccccaggtcctcggacaccgaagagaatgacaagaggcgaacgcacaacgtc
ctggaacgccagaggaggaacgagctcaaacggagcttctttgccctgcgtgaccaaatc
ccagagctggaaaacaatgaaaaggcccccaaggtagttattcttaagaaagccacaaca
tacatcctgtccgtccaagcagaggagcaaaagctcatttctgaaaaggacttgttgcgg
aagcgacgagaacagttgaaacacaaacttgaacagctgcggaactcttgtgcataa

DBGET integrated database retrieval system