KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411984
Entry
100411984         CDS       T03264                                 
Symbol
OVOL2
Name
(RefSeq) ovo like zinc finger 2
  KO
K09216  ovo
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100411984 (OVOL2)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100411984 (OVOL2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_3rep zf-H2C2_5 zf-C2H2_6 zf_C2H2_ZHX FYVE zf-met
Other DBs
NCBI-GeneID: 100411984
NCBI-ProteinID: XP_002747516
Ensembl: ENSCJAG00000005049
UniProt: F7IDA4
Position
5:complement(23630384..23668575)
AA seq 275 aa
MPKVFLVKRRSLGVSVRSWDELPDEKRADTYIPEGLGSLLHDPPEDCRSDGGSSSGSGSS
SAGEPGGAESSSSPQVPERETPELGYADGPEGHLAAKQRPVARSKIKFTTGTCSDSVVHS
CNLCGKGFRLQRMLNRHLKCHNQVKRHLCAFCGKGFNDTFDLKRHVRTHTGIRPYKCNVC
NKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEELYLHVNSAHPGS
SFLKKTSKKLAALLQGKLTSVHQEHTSLSEEEERK
NT seq 828 nt   +upstreamnt  +downstreamnt
atgcccaaagtcttcctggtgaagaggaggagcctgggggtctcggtccgcagctgggat
gagctcccggatgagaaaagggcagatacctacatcccagagggcctgggcagcctgctc
cacgacccccccgaggactgccgcagcgacggtggcagcagcagcggcagcggcagcagc
agcgcgggcgagcctggaggcgccgagagcagctcgtccccgcaagtccccgagcgcgaa
acccccgagctcggctacgctgatggccccgaaggacacctggcggccaagcagcgcccg
gttgccaggtcaaaaatcaagttcaccacaggcacctgcagcgactcggtggttcacagc
tgcaacctgtgtggcaagggcttccgcctgcagcgcatgctcaaccgtcacctcaagtgc
cacaaccaggtgaagagacacctgtgcgccttctgcggcaagggcttcaatgacaccttc
gacctgaagaggcatgtccgcacgcacacaggcattcgtccctacaaatgcaatgtctgc
aataaagccttcactcagcgctgctccctggagtcccacttgaagaaaatccatggggtg
cagcagcagtacgcctataagcagcggcgggacaagctctacgtctgcgaggattgcggc
tacacgggccccacccaggaggaactgtacctgcacgtgaacagtgcccacccgggcagc
tcatttctcaaaaagacgtctaaaaaactggcggcgcttttgcagggcaagctgacatcc
gtacaccaggagcatacaagcctgagtgaggaggaggagaggaagtga

DBGET integrated database retrieval system