KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412924
Entry
100412924         CDS       T03264                                 
Symbol
AGPAT1
Name
(RefSeq) 1-acylglycerol-3-phosphate O-acyltransferase 1
  KO
K13509  lysophosphatidate acyltransferase [EC:2.3.1.51]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00561  Glycerolipid metabolism
cjc00564  Glycerophospholipid metabolism
cjc01100  Metabolic pathways
cjc04072  Phospholipase D signaling pathway
cjc04975  Fat digestion and absorption
Module
cjc_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100412924 (AGPAT1)
   00564 Glycerophospholipid metabolism
    100412924 (AGPAT1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100412924 (AGPAT1)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    100412924 (AGPAT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cjc01004]
    100412924 (AGPAT1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     100412924 (AGPAT1)
Lipid biosynthesis proteins [BR:cjc01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   100412924 (AGPAT1)
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 100412924
NCBI-ProteinID: XP_017826479
Ensembl: ENSCJAG00000001854
Position
4:complement(32745014..32748567)
AA seq 285 aa
MELWPGVWMLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRN
VENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCV
PIAKRELLWAGSAGLXCWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRN
HNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGRCQVRVLPPVPTEGL
TPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGVGEPQL
NT seq 858 nt   +upstreamnt  +downstreamnt
atggagttgtggccaggggtatggatgctactgctcttcctgctgttgctcttcctgctg
cccaccctgtggttctgcagccccagtgccaagtacttcttcaagatggccttctacaat
ggctggatcctcttcctggctgtgctcgccatccctgtgtgtgccgtgcgaggacgcaac
gtcgagaacatgaagatcttgcgtctaatgctgctccacatcaaatacctgtacgggatc
cgagtggaggtgcgaggggctcaccacttccctccctcgcagccctatgttgttgtctcc
aaccaccagagctctctcgacctgcttgggatgatggaagtactgccaggccgctgtgtg
cccattgccaagcgtgagctactgtgggctggctctgctgggctgngctgctggttggca
ggagtcatcttcatcgaccggaagcgcacgggggatgccatcagtgtcatgtctgaggtc
gcccagaccctgctcacccaggacgtgagggtctgggtatttcctgagggaacaagaaac
cacaacggctccatgctgcccttcaaacgtggcgccttccatcttgcagtgcaggcccag
gttcccattgtccccatagtcatgtcctcctaccaagacttctactgcaagaaggagcgc
cgcttcacctcaggacgatgtcaggtgcgggtgctgcccccagtgcccacagaagggctg
acaccagatgacgtcccagctctggctgacagagtccggcactccatgctcactgttttc
cgcgaaatctccactgatggccggggtggtggtgactatctgaagaagcctgggggtgtg
ggtgaaccccagctctga

DBGET integrated database retrieval system