KEGG   Campylobacter jejuni subsp. jejuni IA3902: CJSA_1404Help
Entry
CJSA_1404         CDS       T01854                                 

Definition
(GenBank) putative recombination protein RecB
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
cji  Campylobacter jejuni subsp. jejuni IA3902
Pathway
cji03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cji00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CJSA_1404
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cji03400]
    CJSA_1404
Enzymes [BR:cji01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CJSA_1404
DNA repair and recombination proteins [BR:cji03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CJSA_1404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_12 Viral_helicase1 PDDEXK_1 AAA_30 Lig_C
Motif
Other DBs
NCBI-ProteinID: ADC29040
Position
complement(1413357..1416122)
Genome map
AA seq 921 aa AA seqDB search
MSQFEPFLALEASAGSGKTFALSVRFVALILKGARINEILALTFTKKAANEMQKRIIETF
LNLEKENKTSECNELCKLLGKDKEELISLRDAKKEEFLRTELKISTFDAFFGKILRVFAL
NLGLSSDFTMSEERLDVREIFLKLLKKDELKDLAYYINLVDEKENFFNELEKFYENAYFQ
NRPKILNPTKAYINKAYSELRSYCLGLTHVKNYKNLCDNFKSEVLDLSVFMQSSFMTKFE
STKYLQDLESTNLHFSAKRMELINALNTYAIELENYKIANLMNLLNHYSEAKNIFHKDKN
TLNFQDVSKKVYELITSEFKDMIYFRLDGFISHLLIDEFQDTSVIQYQILRPLIAELVSG
EGVKKNRTFFYVGDKKQSIYRFRKGKKELFDLLKQEFSQIKSDNLNTNYRSKELLVDFVN
ETFKEKIKDYKEQFALESKKGGFVRIVESKEQKVKNQAQEIKEKTLETLFEQINFLRSKN
ISYDDICILCWKNSDADMVLDFLREQNIPAFTQSNVLLENKASVRLVLEYAKYCIFGDEF
YLVFLKELLGFEPRKITLDFSKNAMENVLFLIKELKLDLNDIALIQFIEYAKTKENFLKL
LFEPCALKIVSEQNMGISIMSVHKSKGLEFDHVILLDSLSKNNSNNEDIMLEYDINQGWQ
LHIKDKIRELTKEPIYTLFKENITRANYEDDINKLYVAFTRAKESLIIIKRNEESVNGNY
PSYFKGGFLNIHSQERGFLESKEQILSVKKESIQTLQKFEKITLQEIQSEERLDSKELYF
GNAFHFFMQNLKLPKGENFQILTQRCKSKFRHFLDESDFEKLFKRIEILLKNIQFQNLIG
DGKLLKEQALSFNGEIKQLDLLALKDEEAFIIDYKTGLAMQDKHKEQVGTYKIAISEILQ
KDKVRAFIVYCLENEIQILEI
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatttgagccttttttagcattagaagcgagtgcaggaagcggaaaaaccttt
gccctgagtgtgcgttttgtagcacttattttaaaaggagctaggattaatgaaatttta
gctttgacttttaccaaaaaagctgctaatgaaatgcaaaaaagaattattgagactttt
ttaaacttagaaaaagaaaataaaaccagtgaatgcaatgaactttgcaagcttttaggt
aaagataaagaagagcttatttctttaagagatgctaaaaaagaagaatttttaagaaca
gagttaaaaatcagtacttttgatgcttttttcggaaaaattttgcgtgtttttgcttta
aatttgggcttaagtagtgattttacaatgagtgaagagaggcttgatgtaagagagatt
tttttaaaacttcttaaaaaagatgaattaaaagatttggcttattatattaatttagtt
gatgagaaagaaaatttttttaacgagcttgaaaaattttatgagaatgcttattttcaa
aatcgtcctaaaattctaaatccaactaaagcttatatcaataaagcttatagtgagtta
agaagttattgtttgggtcttactcatgtaaaaaattataaaaatttgtgtgacaatttc
aaaagtgaagttttagatttatccgtgtttatgcaatcaagttttatgacaaaatttgaa
agtacaaaatatttacaagatttagaaagtactaacctgcattttagtgcaaaaagaatg
gagcttataaatgctttaaatacctatgccatagagcttgaaaattataaaattgctaat
ttaatgaatcttttaaatcattatagtgaagctaaaaatatatttcataaagataaaaat
accttaaatttccaagatgtgagtaaaaaagtttatgagttaataaccagtgaatttaag
gatatgatttattttcgtttagatggttttatttcgcatttgcttattgatgaatttcaa
gatacaagcgtgatccaatatcaaattttacgccctttgatcgctgagcttgtttcagga
gaaggggttaagaaaaatcgcacttttttttatgtaggagataaaaaacaaagtatttat
cgctttcgtaaaggaaaaaaagaattatttgatttgttaaaacaagaatttagtcaaatt
aaaagtgataatttaaatactaattatcgttctaaagagcttttggttgattttgttaat
gaaacttttaaagaaaaaatcaaagattataaagaacaatttgccttagaaagtaaaaaa
ggcggttttgtgcgtattgtggagtctaaggaacaaaaggttaaaaaccaagcccaagaa
attaaggaaaagactttagaaactttatttgagcaaattaattttttaagatctaaaaat
atttcttatgatgatatttgtattttgtgttggaaaaatagtgatgcagatatggttttg
gattttttaagagagcaaaatattcctgcatttactcaaagcaatgttttacttgaaaat
aaagcaagtgtaagacttgttttagaatatgctaaatattgtatttttggtgatgagttt
tacttggtatttttaaaggaacttttaggttttgagccgagaaaaattacccttgatttt
tcaaaaaatgctatggaaaatgtactttttttaataaaagaattaaaacttgatttaaat
gatatcgctttaatacaatttatcgaatatgctaaaactaaggagaattttttaaagctt
ttatttgagccttgtgctttgaaaatagtaagcgaacaaaatatgggaattagtattatg
agtgtgcataaatctaagggtttggaatttgatcatgtgattttacttgatagtttatct
aaaaacaattcaaacaatgaagatatcatgcttgaatatgatatcaatcaaggttggcaa
ctccatattaaagataaaattcgagagcttactaaagagcctatttatactctttttaaa
gaaaatattacaagagcaaattatgaagatgatattaataaactttatgtggcttttaca
agagctaaggaaagtttgatcatcataaaaagaaatgaagaaagtgtaaatggaaattat
ccaagttattttaaggggggatttttaaatatacattctcaagagagaggttttttagaa
agcaaagaacaaattttaagcgttaaaaaagaaagcattcaaactttgcaaaaatttgaa
aaaattaccttgcaagaaattcaaagtgaagaaaggcttgatagtaaagaactatatttt
ggaaatgcttttcacttttttatgcaaaatttaaaacttcctaagggtgaaaattttcaa
atacttactcaaagatgcaagagtaaatttagacattttttagatgagagtgattttgaa
aagctttttaaaagaattgaaattttacttaaaaatattcaatttcaaaatttgattggt
gatggaaagcttttaaaagaacaagctttgagttttaatggagaaattaaacaattagac
ttgcttgctttaaaagatgaagaagcttttataattgattataaaacaggtcttgctatg
caagataaacataaagagcaggtaggaacttataagatcgccattagtgaaattttgcaa
aaagataaagtgcgtgcttttatagtttattgtttggaaaatgaaattcaaattttggaa
atataa

DBGET integrated database retrieval system