KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_pVir0007
Entry
CJJ81176_pVir0007 CDS       T00461                                 

Definition
(GenBank) VirD4
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
cjj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cjj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CJJ81176_pVir0007
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cjj02044]
    CJJ81176_pVir0007
Enzymes [BR:cjj01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     CJJ81176_pVir0007
Secretion system [BR:cjj02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   CJJ81176_pVir0007
SSDB
Motif
Pfam: T4SS-DNA_transf TrwB_AAD_bind TraG-D_C DUF418
Other DBs
NCBI-ProteinID: EAQ71774
UniProt: Q8GJE7
Position
pVir:4452..6338
AA seq 628 aa
MNDKKITPAKWVLMFITSIILGIILYLLMVKIIFKPDLLVTHQVGLQIIHNLGNPALKLK
AYVAVFALILPFIVCLIWFFMPQMNLKENYGNARFAKEKDFEEMNICNDRGLILGCNIKK
GIKGDEIEYIRAKMPLSALVVAPPGTGKTSGIILPNLFTVPNSTLALDIKGELYAKSAGY
RKKYFNNEILLFEPFSDNNTLFFNPFDNSIVKDMNFIQMMKLADQIAGTIFVAEKGKEGD
HWVTSAKTLFTFFALYNMQKHKHTSLGDLTQAPKKDYFNELNEEFGKECLIEDEDTGEVS
RDYNVDTFKVFLKQVANDENLDEIVRNQARAYQTAAEQEFASIKSTYDTYMKVFTNPQVA
NATSKMNFRFEDLREKRITMYVVIQTEDMDILAPLVRIFIESLFKKLMSGQENSNPDKFI
YCLLDEFVRFGKMPFLLEAPALCRSYGLIPVFVTQSYEQIRKYYGEDDLGIIRANAGYQT
IFRMNTEKDAKEISDLIGDFTREKTSSSKGTFDFFKSNNTVSKEGYKLITSQDIKNQSSE
DILILVTGFLSRPIKAKVPYWFKNPKLKGADKISLEDNNTNTEGESKNDEINNDDSQNVN
QEQNFTQENSSSKQIFELEELGIKVKKE
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgaatgataagaaaataacccctgcaaaatgggtattaatgtttataactagcattatt
ttaggaataattctttatttattaatggtaaaaattattttcaaacctgatttattagta
acacatcaagttgggttacaaataattcataatttaggaaaccctgcattaaaacttaaa
gcttatgtagcagtttttgctctcattttgccttttatagtctgtttgatttggtttttt
atgccacaaatgaatttaaaagaaaattacggaaatgcaagatttgctaaagaaaaagat
tttgaagaaatgaatatttgcaatgataggggtttaattttaggttgtaatattaaaaaa
ggtataaaaggcgatgaaatagaatacatcagagctaaaatgcccctaagtgcgttggtg
gttgcaccaccaggcacaggtaagacttcaggtatcattttacctaatttatttacagtt
cctaattctactttagcacttgatattaaaggcgaactttatgcaaaaagtgcaggttat
agaaaaaaatattttaataatgaaattttattatttgaacctttttcagataataatact
ttatttttcaacccttttgataattctatagttaaagatatgaattttatccaaatgatg
aaattagcagatcaaatcgcaggaactatatttgtagctgaaaaagggaaagaaggcgat
cattgggttacaagtgcgaaaactcttttcactttttttgcattatacaatatgcaaaaa
cacaaacatacgagtttaggagatttaactcaagctccaaaaaaagattattttaatgag
ttaaatgaagaattcggaaaagagtgtttaattgaagatgaagacacaggagaagtttca
agagattataatgtagatactttcaaagtatttttaaaacaagtggctaatgatgaaaat
cttgatgagatcgttagaaatcaagcaagggcttatcaaacggctgccgagcaagaattt
gcaagtattaaatcaacttatgatacttatatgaaagttttcactaatccacaagtggct
aatgcaacttcaaaaatgaattttagatttgaagatttaagagaaaaaagaattactatg
tatgtagtaatacaaaccgaagatatggatatattagctcctttggtgcgtatttttatc
gaaagtttatttaaaaaactaatgagcggacaagaaaattctaatcctgacaaattcatt
tattgcttattagatgaatttgtgagatttggaaaaatgccttttttacttgaagcacct
gcattatgtagatcttatggacttattcctgtatttgttactcaatcatacgagcaaatt
agaaaatattatggcgaagatgatttaggaattattagagcaaatgcaggttatcaaact
atttttagaatgaatacagaaaaagacgctaaagaaattagcgatctaatcggcgatttt
accagagaaaaaacatcatcatcaaaaggaacttttgatttctttaaaagtaataacact
gtatccaaagaaggttataaattgataacttcacaagatattaaaaatcaatccagtgaa
gatattttgattttagtaacaggatttttatcaagacctattaaagctaaagtgccttat
tggtttaaaaatccaaaacttaaaggagcggataagatttctttagaagataataatact
aatacggaaggagaaagcaaaaatgatgagattaataatgatgatagccaaaatgttaat
caagaacaaaactttactcaagaaaattcaagctctaaacaaattttcgaacttgaagaa
ctaggaataaaggtaaaaaaagaataa

DBGET integrated database retrieval system