KEGG   Clostridium sporogenes: CLSPO_c12940
Entry
CLSPO_c12940      CDS       T03905                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cld  Clostridium sporogenes
Pathway
cld00230  Purine metabolism
cld01100  Metabolic pathways
cld01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cld00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLSPO_c12940 (xdhA)
Enzymes [BR:cld01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CLSPO_c12940 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AKC62014
UniProt: A0A1V9IK05
Position
1406468..1408765
AA seq 765 aa
MEDSYDLIGKSVNRVDAVAKVTGKAKYCSDYFEPDSLVGMVLRSPYAHAKVKNIDTKEAE
NLEGVEAVLTYKNVPNTKFPTAGHPYSLDPSHRDIEDYSLLTDKARFVGDAVAAVVANDE
LIAKKALKLIKVEYEILPFVMDQEEAIKEGAPVIHDERPNNIVSDFGITVGDPDEVFKNA
DKIYKGQYETQIVQHCQMETHNAMAKIDEKGRMLIITSTQIPHIVRRIVSKACNLPIGRI
RVIKPYVGGGFGGKQDVIIEPLTAIMSLAVNGRCVRLQLSREEAIVSTRTRHAMRVNIKM
ALSKNNKIEGYDIENFVNNGAYASHGHSIAMSAGSKIRPLYDIKAEKYRPKTIYTNLPVA
GAMRAYGIPQMCFVIESMVDDICEDLNIDPVDFRINSFIKKGHIDNASGLVVRTFGLPEC
LKRGRELIDWDRKRQLYKNQNGSIRKGVGMACFSYFSGTWPVSLEAAGARIVMNQDGSVQ
VQVGATEIGQGSDTVFSQMAAETIGIPFDMVTIVSQQDTDITPFDTGSYASRQSFIAGQA
IKKAAIEVKRKVLEIASDKCGLDAELLDIVDAKIIEKGLRREIYTLEEIALEAYYNREKY
APITSDLTVKVKNNAIAYGATFVEVEVDIKTGKIKVLDIYNVHDSGKILNKKLAEGQVHG
GVSMALGFALSEKFIIDEKTGSIINNNLLHYKLQTIMDTPNIKCEFVNTYDPTSSYGQKS
LGENTTISPAPAIRNAVLNATGVAFNKLPMDAQTVFEKFRKVGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagattcttatgatttaattggaaaaagcgtaaatagggtagatgcggtagctaaa
gttacaggtaaagctaagtattgttcagattattttgaacctgactcacttgtaggaatg
gttttaagaagtccttatgcccatgcaaaagtaaaaaatatagacactaaagaagctgaa
aatttagaaggtgttgaagctgtattaacatataaaaatgtaccaaatacaaagttccct
acggcagggcatccatattcattagatccaagtcatagagatatagaagattattcatta
cttacagataaagcacgttttgttggagatgcagttgcagcagttgttgcaaatgatgaa
cttatagctaaaaaagctttaaaattaataaaagtagaatatgaaattttaccttttgta
atggatcaagaagaagcaataaaagagggggctcctgttattcatgatgaaagacctaat
aatatagttagtgattttggtataacagtgggagatccagatgaagtatttaaaaatgca
gataaaatttataaaggccaatatgaaactcaaatagtacaacattgtcaaatggaaact
cataatgctatggcaaagattgatgagaaaggtagaatgcttattattacatcaacacag
ataccacatattgtacgaaggatagtttcaaaagcttgtaatttaccaattgggagaata
agggtaataaagccttatgttggtggaggctttggaggaaaacaggatgttataatagag
ccacttacagctataatgtctcttgcagttaatggaagatgtgtaagactacaattaagt
agagaagaggcaattgtttcaactagaacaagacatgcaatgcgagtaaatattaaaatg
gctttatcaaaaaataataaaatagaaggttatgatatagagaacttcgtaaataatgga
gcttatgcatcccatggacattcaattgctatgagtgcaggaagtaaaattagacctctt
tatgatataaaggcagaaaaatatcgtccaaaaactatatatactaaccttccagttgca
ggtgcaatgagagcatatggtataccacaaatgtgttttgttatagaatctatggttgat
gatatatgtgaggatttaaatatagaccctgtagattttagaattaatagttttataaaa
aagggtcatatagacaatgcatcaggacttgtagttagaacctttggattaccagaatgt
ttaaaaagaggtagagaattaatagattgggacagaaaaagacaattatataaaaatcaa
aatggttctataagaaaaggtgttggaatggcttgctttagctatttttcaggaacttgg
ccagtatcacttgaggcagcaggagcaagaatagtaatgaatcaagatggctcagttcaa
gttcaagtaggggctacagaaataggacagggtagtgatacggtatttagtcaaatggca
gcagaaactattggaataccatttgatatggtaacaatagtatctcagcaagatacagat
attactccatttgatacgggttcttatgcatcaagacaatcttttatagcaggtcaagct
ataaaaaaagcagcaatagaagtaaaaagaaaggttctagaaattgctagtgataagtgt
ggattagatgcagaacttttagatattgtagatgcaaagataatagaaaaaggattaaga
agagaaatttatactttagaagaaattgcactagaagcatattacaacagagaaaaatat
gcacctataacaagtgatttaactgtaaaggttaaaaataatgctatagcttatggggca
acctttgtagaagttgaagttgatataaaaacaggaaaaataaaagttttagatatttat
aacgtacatgattcaggaaaaattttaaacaaaaagttagcagaaggacaagtacacggt
ggtgttagtatggccttaggatttgccttatcagaaaaatttataatagatgaaaaaaca
ggatctataataaataataatcttttacattataagcttcaaactattatggatactcca
aatataaaatgtgaatttgtaaatacttatgatccaacatctagttatggacaaaaatct
ttaggtgaaaatacaacaatttctccagcaccagctatacgtaatgctgtattaaatgca
acaggagtagcatttaacaaattgccaatggatgctcaaactgtttttgaaaaatttaga
aaggttggacttatatag

DBGET integrated database retrieval system