KEGG   Cyanidioschyzon merolae: CYME_CMQ429CHelp
Entry
CYME_CMQ429C      CDS       T00175                                 

Definition
(RefSeq) centromere protein E, CENP-E protein
  KO
K11498  centromeric protein E
Organism
cme  Cyanidioschyzon merolae
Brite
KEGG Orthology (KO) [BR:cme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cme01009]
    CYME_CMQ429C
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cme03036]
    CYME_CMQ429C
Protein phosphatases and associated proteins [BR:cme01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CYME_CMQ429C
Chromosome and associated proteins [BR:cme03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     CYME_CMQ429C
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     CYME_CMQ429C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kinesin Microtub_bd
Motif
Other DBs
NCBI-GeneID: 16996504
NCBI-ProteinID: XP_005538301
UniProt: M1V6K8
Position
17:1119242..1122769
Genome map
AA seq 1175 aa AA seqDB search
MSGVELPEAETRSVLSDAIQVAVRVRPILPKEAETRGAAETWRAVPHAGQVIRVGRLPTG
AGGTTTCPTVFSYDFVFGKESTNVEVYEKVARPLVESALVGYNGTVFAYGQTSSGKTHTM
WGSEADPGVMRRAVRDLFELARRTPQREFLIRVSYLEIYNETIRDLLHSNPAVTNVRVLE
DSDGRICTDAREEIVVTAEQVCELLKNGEAKRMTGATDMNERSSRSHTILTLVIESRERA
AEDSTSGDAEDSSSASDSAVRTATLTLVDLAGSERQKDAKSEGLRLKEGGYINKSLLTLG
TVIHKLSEGGSAHVPYRDSKLTRMLQSSLGGNSRTAVICAITPAAAHAEETLSTLKFATR
AKSVQNRAQQNEVLDDRALLKRYQQEIASLRAQLAKLQQGDLSKQGCPNDFVRALEQNAA
EAERERERIRSQLEEAENRRRLYEEKLERLTRLILNSPAPAPKVRSRVSVSTASLSSPHS
DTNENKDVASPGAFAYEPRTPPAAEPQLDQRLTRTFRTLRRRTLGGSVDGIGSDAQGLLN
SPENHIVEQVRTLQRRVEALDVARWREQSASLKAVSYERERAAQLQQRLRSLESQMLRHT
CAEVANEALHKAALAAVDVRLAQIQQLMQSERNRMQQLHCELEHVRQVCATKQSRLEILE
RELGEARREIDELRQRERAGFTQTQAKTFDHLRNRVADLEAKLRSQLALRQQVEASRGGV
ERELRKLERQNRALEKELAKLREQRERIEQAKLTVAQAEQLRNASEQAQRQVQAERDALQ
RQLNELENAHTRLLAERDTLLEYRERHQQALEQLECAQQRIADLEARSVRSADWEARCES
LSGQLEDARQRIAALESQIETNAQELASLLDQATDAHLQLEAVRSQARASERLQEQVTAQ
VRAELNALAASHEKESAEWKRMRLDTETERDALRSQLADHKRSLEELRLECAKLESRAAK
LLQETAKHIEEKHRLLETVHARDRRITDLESRLRECVEGGGRYARLCRLVEKREAELTRA
RETLRLLEERLVAEGRSAEFCDLHASAQHEAERLSFEKELARSKEKSDKMQQERQQLLLE
NSKLRDVVKHKDRQLLSLQAKLKHAEATILSQRGNASLPEQGTVSDISMGAGAAPACVTQ
SAPGAQDSNNKENLGCEQDSERAAAQLFGSLDDNK
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagtggaactcccagaagcagagacgaggtcagttctttccgatgcgattcaa
gtggcggttcgtgttcgtcctattcttccgaaagaagcagagactaggggtgcggctgag
acctggcgcgctgtacctcacgcaggtcaagtgatccgcgttggccggcttcccacgggt
gccggaggcacgacgacctgcccgactgtcttctcgtatgatttcgtgttcggtaaggag
tccaccaacgtagaagtctacgaaaaggtggcgaggcctctggttgaaagcgctctagtt
ggttacaatggcaccgtctttgcctatgggcagacgtcttccgggaaaacgcacaccatg
tggggcagcgaggcggatcccggtgtcatgcgtcgggctgtacgtgacctcttcgagctt
gcgcgccgaacgcctcagcgagagttcctcattcgggtgtcttacctggagatctacaac
gagactatcagagatctgctgcattcgaacccagccgtgaccaatgtccgggttcttgag
gatagcgatggtcgcatctgcaccgatgcgcgagaggaaatcgttgtcactgctgagcaa
gtctgtgagttgctcaagaatggcgaggcgaagcgtatgaccggagcaacggacatgaat
gagcgaagttctcgctcgcacacgatcctgacactagtgattgagagcagggagcgcgct
gcggaagactcaacctctggggatgccgaagactcgtcatccgcgagcgattccgctgtg
cgaaccgcaacgctcacactcgtcgacctggccggatcagagcgccagaaggacgccaag
tccgaaggtttacgtttgaaggagggtggctacatcaacaaatccttgttgacattgggc
actgtcattcacaagctctcggagggaggcagtgcccatgtaccttatcgcgattcgaaa
ctcacgcgaatgctgcagagctccctcggtggcaactctcgaaccgcggttatctgcgca
attacgccggctgcagcgcacgctgaggagacgctgtcgaccctcaaattcgcaacacga
gccaagagtgtgcaaaaccgtgcccagcagaacgaggtgctcgatgatcgagccctgttg
aaacgttaccaacaggagatcgccagtctgcgtgcacagctagcgaaactgcaacaggga
gatctaagcaaacaaggatgcccaaacgactttgttcgtgctcttgagcagaacgctgca
gaagcggaacgcgagcgtgagcgtatccgttctcagctagaggaagcggagaacaggcgt
cgcctctacgaggagaaactggagcgcttgacgcgtttgatattgaactcgccagctcct
gcgccgaaggtgcggtcgcgggtctccgtgtcgacggcgtccttgtcgagtcctcactcg
gacacgaacgaaaacaaggacgtggcttcgcccggcgcgtttgcttacgagcctcgaaca
ccgccagctgctgaaccacagcttgatcagcgcttgacgagaacgtttcgaacgctgcga
cggcggacgcttggtggtagcgtcgatggcattgggagcgatgcccaaggcttacttaac
tcgcccgagaatcatatcgtggagcaggttcgaacacttcagcgacgagttgaggcacta
gatgtggcccgatggcgcgaacagtcagcctcattgaaggcagtctcctacgaacgtgag
cgtgctgcgcagctgcaacaacgtctgcgttcgctcgagtcgcagatgcttcgccacacc
tgcgccgaagttgccaacgaagcgctgcacaaagctgcgctcgcagctgtcgatgtgcgg
cttgctcagatccagcagttgatgcaaagcgagcggaatcgaatgcaacagctgcattgt
gaacttgaacacgttcgacaagtctgcgcaaccaagcaatcccgactcgagatactcgaa
cgagaactcggtgaagcgcgcagagaaatcgacgaactacgccagcgtgaaagagctgga
tttactcaaacgcaagcgaagacttttgatcatctacgcaatcgcgttgccgatctcgaa
gcgaaacttcgttcgcaactcgcactacggcaacaagtggaggcctcgcgaggcggagtc
gaacgtgaactgcgcaaattggagcgccagaatcgagcactggaaaaggagctcgccaag
ctccgcgaacagcgcgaacgaatcgagcaggcgaagctcacggtagcgcaagcggaacaa
cttcgcaatgcgtcagaacaagcgcaacgccaagtgcaagctgagcgggatgcgctgcag
cgccagttgaacgaactcgaaaacgcccacacacgccttctcgctgagcgtgataccttg
ctggagtaccgggagcggcaccagcaggccctcgagcagctggaatgcgcccagcagcgg
atcgcggatctcgaagcgcgatctgtgcgctccgctgactgggaagcgcgctgcgaatcg
ctctccgggcaactcgaggatgccaggcagcgtattgctgctttggaatcgcagatcgaa
accaatgcccaggaattggcttcattactggaccaggcaacagatgctcatctgcagcta
gaggcggtgcgatcccaggctcgcgctagtgagcgtttgcaggaacaggtgacggcgcag
gtgcgtgcagagctgaacgccctggcggccagtcatgaaaaagagagcgccgagtggaaa
cgcatgcgactggacaccgagacggaacgagatgcgcttcgttcccagctcgctgaccat
aagcgttcgctcgaggagctgcgtcttgaatgcgctaagctcgagtcacgggcagcgaag
cttctccaggaaaccgcgaagcatatcgaagagaagcatcgtctcctcgagactgtgcat
gcgcgcgatcgacgcattaccgaccttgaaagtcgcctccgcgagtgtgtcgaaggaggt
ggtcgctatgcgcgtctctgtcgacttgttgaaaagcgcgaagcagagctgactcgcgcc
cgcgaaactctgcggctgctggaggagcgtcttgtcgccgaagggcgctctgcagagttc
tgtgacctccatgcgagtgcgcagcatgaggccgagcgcttgagctttgagaaggagctt
gctcgctccaaagaaaaaagcgacaagatgcagcaagaacgacaacagctgttactcgag
aacagcaaattgcgtgacgtagtcaagcacaaggaccgacagcttctgagtctgcaggct
aagctgaagcacgccgaggcaaccatcttgtcgcagcgcggcaatgcgagtcttcctgaa
cagggcaccgtctcagacatttccatgggggcaggtgccgctcctgcatgtgtaactcaa
agtgctcctggcgctcaagattccaataacaaggagaatttgggatgcgaacaggattcg
gaacgtgctgctgctcagctgttcggatcgctcgacgacaacaagtag

DBGET integrated database retrieval system