KEGG   Callorhinchus milii (elephant shark): 103172020Help
Entry
103172020         CDS       T03088                                 

Gene name
dhx8
Definition
(RefSeq) DEAH-box helicase 8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103172020 (dhx8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cmk03041]
    103172020 (dhx8)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103172020 (dhx8)
Spliceosome [BR:cmk03041]
 Complex C
  Other components
   Step II factors
    103172020 (dhx8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 PRP38_assoc Sigma54_activ_2 AAA_30 AAA_16 ABC_tran Flavi_DEAD Presenilin PhoH AAA_7
Motif
Other DBs
NCBI-GeneID: 103172020
NCBI-ProteinID: XP_007883013
Position
Un
AA seq 1196 aa AA seqDB search
RSFNVEGVVRRAPGVTKLPCFSPFPAEFIISLAEKHNTFETFKRMLLKNGAEFTDSLISN
LLRLIQTMRPPPKPLTSSKAAETTKPKSEKEKMKELFPVLCMPDNPTIKTLLDPDDLKVA
ADALKELEALMPSKEDIRKSSKHSSVDKGKRRKRSRSRDRKRRRHSRSRSRSRDRTRSRT
GRRSRSRSRSGSRNRDHKERERERERERERERGVRLGGEKAGEKWKERHVDRPPPEEPSV
GDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVL
SFTGSKTSLSMKDVDQESGEDLNPNRRRNVGGETSEETTMRNPDRPSNLSLVNTPEVEDD
MLERKRLTKISDPEKWEIKQMIAANVISKEEYPDFDEETGILPKVDDEEDEDLEIELVEE
EPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMMQSALAKERREMKQAQREAEMDSIPMG
LNKHWVDPLPDVDGRQIAANMRGIGMMPQDIPEWKKHAFGGNKASYGRKTQMSILEQRES
LPIYRLKEQLVQAVHDNQVLIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAM
SVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPNLSQYAIIML
DEAHERTIHTDVLFGLLKKTVKKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPV
EVLYTKEPETDYLDSSLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSMGPDV
PELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKV
YNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTN
LASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFP
LEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQAEGDHLT
LLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQ
KAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMRE
VTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
agaagttttaacgtggaaggagttgtgcgcagggcgccaggagtaacaaagctgccttgt
ttctctccgttcccagcggagttcatcatcagtctcgcggagaagcacaacacgttcgag
actttcaagcggatgctcctgaaaaatggggccgagtttacggattcgctcatcagcaat
ttgttgcgtctgatacagaccatgaggccacctcccaagcccttgacgtccagcaaagct
gctgaaaccaccaaaccgaagtcggaaaaggaaaagatgaaggagcttttcccggtgctc
tgtatgcccgacaaccccacgatcaagacgctgctggatccagatgatttgaaagtggca
gccgatgccctgaaggaactcgaggccctgatgccgtcgaaggaagacattagaaagagc
agcaagcacagctcggttgacaaaggcaagaggaggaaacgcagccggagtagagaccga
aagcgtcgacggcattccagatcccgatcacgttcccgggaccggaccaggagcagaacc
ggcaggaggtccaggagccgaagtcgaagcgggagccggaacagagaccacaaggagaga
gagagggaaagggagagggagagggagagagagaggggcgtccgcctcgggggagagaag
gccggagagaagtggaaggaacgtcacgtagacagacccccgccagaggagccctcggtg
ggcgacatctacaacggcaaagtcaccagcatcatgcagttcggatgctttgtgcagctg
gaagggctcaggaaacgatgggagggtttggtgcacatctccgagctcaggagagaggga
cgtgtggccaacgtggcggatgtcgttagcaaaggccagagagtgaaagtcaaggtgttg
tctttcactggatccaagaccagcctcagtatgaaggatgtggatcaggaaagcggagag
gacctgaatccaaaccgccgcaggaacgtggggggagagacgagcgaggagaccaccatg
aggaacccggacagacccagtaacctgtcgctggtcaacacgcccgaggtggaggatgac
atgctggagcgcaagcgactgacaaagatctcggacccggagaagtgggagatcaaacag
atgatcgcggcgaacgtcatctccaaagaggagtaccctgacttcgacgaagagacgggg
attcttcccaaggtggatgacgaggaagacgaggacctcgagatcgagctggtggaagag
gagcctccgttcctcaggggccacaccaaacagagcatggacatgagtcctgtcaaaata
gtcaagaatcccgacggctccctatcccaggccgccatgatgcaaagtgcgttggcgaag
gagaggcgggagatgaagcaggctcagcgggaggcggaaatggactccatccccatggga
ctgaacaagcactgggtcgatccactacccgatgttgacgggcgacagattgcggccaac
atgcgaggcatcgggatgatgccccaggacatccccgagtggaagaagcacgcgttcggg
gggaacaaagcctcttacggacgcaaaacccagatgtccatcctggaacagagagaaagc
ttgcccatctacaggctgaaagagcagctggtccaggcggttcacgacaaccaggtgctg
atcgtgatcggggagacgggctccggtaaaaccacgcagatcacccagtacctggcggag
gccggctacaccacccgggggaagattggctgcacgcagccccggcgtgtggctgccatg
tccgtagccaagcgtgtatccgaggagtacggctgctgcttggggcaggaggttggctac
accatccgattcgaagattgcaccagccccgagacggtgatcaagtacatgacggacggg
atgttgctacgagagtgtcttatcgaccccaacctctcgcagtacgccatcatcatgctg
gacgaggcccacgagaggacaatccacactgacgtcctcttcgggctgttgaagaagacc
gtcaagaaacggcccgatatgaagttgatcgtgacgtcagccacgctggacgcggtcaag
ttctcacagtatttctacgaggctccgatcttcaccatccccgggaggacgtacccggtg
gaggttctttacacgaaggaacccgagacggattacctggactccagtctgatcacagtc
atgcagatccatctcacagagccaccgggagatatcctggttttcctgacgggtcaggag
gagattgacacggcgtgcgagatcctgtacgagcgaatgaagtccatggggccggacgtg
cccgagttgattatcctgcctgtgtactcagccttgccgagcgagatgcaaaccagaata
ttcgacccagcgcctcccggcagcaggaaggttgtgatcgccaccaacattgcggaaacc
tcactgaccatcgacggcatttactatgtggtggaccccgggttcgtcaagcagaaagtc
tacaactccaaaaccggcatcgatcaactcgtggtcactccaatatcacaggcacaagcc
aagcagcgagccgggcgcgcaggcaggacagggcccggcaagtgctacaggctgtacacc
gagcgagcctacagagacgagatgctcaccactaatgtgcccgagattcagaggaccaat
ctggccagcaccgtgctgtcccttaaggctatgggcatcaatgacctgctatcgtttgat
ttcatggacgcccctcccatggagacgctcatcacggccatggagcagctgtacactctg
ggggcgctcgacgacgagggtttgctgacgaggctcggacgcaggatggcggagtttccc
ctggagccgatgctgtgtaaaatgctgatcatgtccgtgcacctcggctgtagcgaggaa
atgctgactatcgtttctatgctgtctgtacagaacgtcttctatcgacccaaagataaa
caagccctggccgatcagaagaaggccaagttccaccaggcggaaggcgaccacctcacc
ttgctcgccgtctacaactcgtggaagaacaacaagttctccaacccctggtgctacgag
aacttcatccaggctcgctccctccgtagggctcaggacatccgcaagcagatgctcggg
atcatggacaggcacaaactggacgtggtgtcgtgcggcaaagccacggtgcgggtccag
aaagccatctgcagcggcttcttccgcaacgcggccaagaaagacccccaggagggttac
cggaccctgatcgaccaacaggtggtgtacatccacccttccagcgccctcttcaaccgc
cagccagaatgggttgtgtatcacgagctggtcctgaccaccaaggagtacatgcgagag
gtcaccaccattgacccccgttggctggtggagttcgctccggccttcttcaaggtctcc
gaccccaccaagctcagcaagcagaagaagcagcagcggctggagcctctgtacaaccgc
tacgaggagcccaacgcctggagaatctctcgcgcgttcaggcgccggtga

DBGET integrated database retrieval system