KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBC4700Help
Entry
CNBC4700          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb03040  Spliceosome
cnb04141  Protein processing in endoplasmic reticulum
cnb04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CNBC4700
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CNBC4700
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CNBC4700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cnb01009]
    CNBC4700
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cnb03041]
    CNBC4700
   03009 Ribosome biogenesis [BR:cnb03009]
    CNBC4700
   03110 Chaperones and folding catalysts [BR:cnb03110]
    CNBC4700
   04131 Membrane trafficking [BR:cnb04131]
    CNBC4700
   03051 Proteasome [BR:cnb03051]
    CNBC4700
   03029 Mitochondrial biogenesis [BR:cnb03029]
    CNBC4700
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cnb04147]
    CNBC4700
Protein phosphatases and associated proteins [BR:cnb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CNBC4700
Spliceosome [BR:cnb03041]
 Complex B
  Other components
   Prp19 complex
    CNBC4700
 Complex C
   Prp19-CDC5 complex
    CNBC4700
Ribosome biogenesis [BR:cnb03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    CNBC4700
Chaperones and folding catalysts [BR:cnb03110]
 Heat shock proteins
  HSP70 / DNAK
   CNBC4700
Membrane trafficking [BR:cnb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    CNBC4700
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    CNBC4700
Proteasome [BR:cnb03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    CNBC4700
Mitochondrial biogenesis [BR:cnb03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    CNBC4700
Exosome [BR:cnb04147]
 Exosomal proteins
  Proteins found in most exosomes
   CNBC4700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A LMP
Motif
Other DBs
NCBI-GeneID: 4935135
NCBI-ProteinID: XP_776415
UniProt: Q55VL6
Position
3
AA seq 644 aa AA seqDB search
MTKAIGIDLGTTYSCVAVWQNDRVEIIANDQGNRTTPSYVAFNDSERLIGDAAKNQVAMN
PYNTVFDAKRLIGRKFNDAEVQADMKHWPFKVVEKGGKPVIKVEYKGEEKTFTPEEISSM
VLTKMKETAEAYLGGTVSKAVVTVPAYFNDSQRQATKDAGAIAGLDVLRIINEPTAAAIA
YGLDKKSEGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFV
QEFKRKNKKDLSSNARALRRLRTACERAKRTLSSAAQTTIEIDSLFDGIDFYTSITRARF
EELCQDLFRSTMDPVEKVLRDSKIDKSSVNEIVLVGGSTRIPKIQKLVSDMFSGREPNRS
INPDEAVAYGAAVQAAILTGDTSEATQDLLLLDVAPLSMGIETAGGIMTPLIKRNTTVPT
KKSEVFSTYSDNQPGVLIQVFEGERAKTKDCNLLGKFELSGIPPAPRGVPQIEVSFDIDA
NGILNVNAADKSTGKTSKITITNDKGRLSKEEIERMLAEAERFKAEDEAAAATVQAKNGL
ESYAYSLKTTLSDNKDKFDSADHETLSKKVEEVINALDTMQSASKEEFESLQKELEGIAN
PIMTKFYGASGGMPGGAGAPGGFPGGGAGGGAAQEEGPSVEEVD
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagcaatcggtatcgacttgggcaccacctactcttgtgttgccgtctggcaa
aacgaccgggtagaaattattgccaacgatcagggcaatcgaacaacaccatcatatgtt
gctttcaatgactctgagcgacttatcggtgatgccgcgaagaatcaggttgcaatgaat
ccttacaacactgttttcgatgctaagcggttgatcggccgtaagtttaacgatgccgaa
gttcaggccgacatgaagcattggcctttcaaggtcgtcgaaaagggaggcaagcctgtc
atcaaggtggagtacaagggagaagagaaaacttttactcctgaggagatttcctccatg
gttctcactaaaatgaaggagactgctgaggcttatctcggtggcactgtctctaaagcc
gtggttaccgtccccgcctacttcaacgactctcagcgtcaggctactaaggacgccggt
gccattgccggtcttgatgtcctccgtattatcaacgagcctactgccgctgctatcgcg
tacggtcttgacaagaagtctgagggcgagaagaatgttttgatcttcgacctcggtggt
ggtactttcgatgtctctctcttgactattgaggagggtatcttcgaggtcaaggctacc
gctggtgacactcaccttggtggtgaggactttgacaaccgacttgtcaaccactttgtc
caggagttcaagaggaagaacaagaaggacctttcttctaacgcccgagctctccgacga
cttcgaaccgcctgtgagcgagctaagcgaactctttcttccgctgctcagaccacgatt
gagatcgactctctcttcgatggtatcgacttctacacttccatcactcgtgcccgattc
gaagagctctgtcaggacctcttccgatccaccatggaccccgtcgagaaggttctccga
gactccaagattgacaagtcctccgttaacgagattgtccttgtcggtggttccacccgt
atccccaagatccagaagcttgtttccgacatgttctctggtcgagagcccaacaggtcc
atcaaccctgacgaggccgttgcctacggtgccgccgtccaggctgctatcctcactggt
gacacttctgaggccactcaggacttgctcttgctcgatgttgcccctctttccatgggt
atcgagactgccggtggtatcatgacccccttgatcaagaggaacaccactgtccccacc
aagaagtctgaggtcttctctacctactctgacaaccagcctggtgtcttgatccaggtc
tttgagggtgagcgagccaagactaaggattgcaacttgctcggcaagtttgaattatcc
ggtattcctccggccccccgaggtgtccctcaaatcgaagtgtcctttgacattgacgcc
aacggcatcctgaatgtaaacgccgccgacaaatctaccggtaagaccagcaagatcacc
atcaccaatgacaagggtagactgtccaaagaggaaattgaacggatgcttgctgaagct
gagagattcaaggccgaagatgaggccgctgcagctactgttcaagccaagaatggtctt
gaatcttatgcctactctcttaagacaaccttgtctgacaacaaggacaagttcgactcc
gccgatcacgaaacgctctcgaagaaggtcgaggaggtgattaacgctctcgacactatg
cagtctgcttctaaagaagagttcgagagtttgcagaaggagctggagggtattgccaac
ccaatcatgaccaaattctatggcgcaagcggtggaatgccaggcggtgccggtgcccct
ggaggattccctggaggtggcgctggcgggggtgctgctcaagaggagggtccttcagtt
gaggaagttgattag

DBGET integrated database retrieval system