KEGG   Chryseobacterium piperi: CJF12_05130Help
Entry
CJF12_05130       CDS       T05071                                 

Definition
(GenBank) L-lysine 6-transaminase
  KO
K03918  L-lysine 6-transaminase [EC:2.6.1.36]
Organism
cpip  Chryseobacterium piperi
Brite
KEGG Orthology (KO) [BR:cpip00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpip01007]
    CJF12_05130
Enzymes [BR:cpip01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.36  L-lysine 6-transaminase
     CJF12_05130
Amino acid related enzymes [BR:cpip01007]
 Aminotransferase (transaminase)
  Class III
   CJF12_05130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Endonuc-HincII
Motif
Other DBs
NCBI-ProteinID: ASW76382
UniProt: A0A086AFX3
Position
complement(1152202..1153527)
Genome map
AA seq 441 aa AA seqDB search
MEQTIDIKANKVKETVGKHVLADGFDFVMDIEKSHGSWLYDKLTDREFLDMFSMFGSGSI
GYNHPYVVAKSDWLGKMAVNKPTLADVYSEEYAHFLEVFERVVIPEELQYAFFIEGGTLG
VENAMKACFDWKTRKNFEKGLQTEAGICIHFRQAFHGRSGYTLSLTNTSDPRKYQYFPMF
EWPRILNPKLIFPITEENLEETIKNERLALVHIGEAILSNPDKVACIIIEPIQAEGGDNH
FRDEFFVELRKICDDNDILLIFDEVQTGIGITGEMWAFQHFTAKPDIISFGKKAQVCGVL
ANKEKFDQIANNVFRESSRINSTFGGNFIDMLRFQLVMEVIEKENLVENARLVGEYLLEG
LQGLAQKYPEKISNARGKGLMCAIDLPSGEQRDHLRDELFKDGLIILGCGDQSLRFRPHL
NVSREEIQLALDKIENNINKI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacaattgatataaaagcaaacaaagtaaaagaaacagtagggaaacatgta
ctggcagacggttttgattttgtaatggatattgagaaatcacacggatcatggttatat
gataaacttactgatagagaatttttagatatgttttcgatgttcggatccggatctatc
ggatacaaccatccttatgttgtagcaaagtcagactggttagggaaaatggctgtaaat
aagcctactttagctgatgtctattctgaggaatacgctcattttcttgaagtttttgaa
agagtggttattcctgaagagcttcaatatgccttttttattgaaggtggaacattagga
gttgaaaatgctatgaaggcatgttttgactggaaaacgcgtaagaattttgaaaaaggt
cttcagactgaggccgggatttgtatccatttcagacaagcattccatggaagaagcggt
tatactttaagtttaacgaatacttctgatcctagaaaatatcaatatttcccaatgttt
gaatggccgagaatccttaatccgaaactgatcttcccaattactgaggagaatttggaa
gagaccattaaaaatgaaagattagcattagttcatatcggagaggcgatactttctaat
ccggataaagttgcatgcattattatagaacctattcaggctgaaggaggggacaaccat
ttcagagatgagttttttgttgaattgagaaagatttgtgatgacaatgacatcttattg
atttttgacgaagtacagacaggaatcgggatcactggtgaaatgtgggctttccaacat
tttactgcaaaacctgatattatctcttttggtaagaaagctcaggtatgtggcgttttg
gctaacaaagaaaaatttgatcagattgctaataatgtttttagagaaagttcaagaatc
aattccactttcggaggaaactttattgatatgcttcgtttccaattggtgatggaagtc
attgaaaaagaaaacttggttgaaaatgcaagattggtaggagaatatctattagaaggc
ttacaaggtctggctcagaaatatcctgaaaaaatttccaatgcaagaggaaaaggatta
atgtgtgcgatagatttaccgtcaggagaacaaagagatcatttgagagatgaacttttt
aaagatggattaattattttaggttgtggcgatcagtcgcttcgttttagacctcatttg
aatgtttccagggaagaaattcaactggctttagataaaatagaaaataatattaacaaa
atttaa

DBGET integrated database retrieval system