KEGG   Coprothermobacter proteolyticus: COPRO5265_0268Help
Entry
COPRO5265_0268    CDS       T00773                                 

Definition
(GenBank) monoacylglycerol lipase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
cpo  Coprothermobacter proteolyticus
Brite
Enzymes [BR:cpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     COPRO5265_0268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 BAAT_C Peptidase_S9 DLH UPF0227 DUF3141 Abhydrolase_5 Esterase Abhydrolase_3
Motif
Other DBs
NCBI-ProteinID: ACI17469
UniProt: B5Y789
Position
complement(259063..259785)
Genome map
AA seq 240 aa AA seqDB search
MEEAFFKEGNDVGVLVIHGFTGSPGSMRDLAQFYADQGFTVALPRLAGHGTTPEDLEKRK
YQEWIEDVEKAYEWLKERTSKRFVTGLSMGGTLTLYMGEKHKDITGLITINAAVRMPNET
SMLILGSLGIPRFAKGVGSDIKKGIKEPAYELTPIRATKQLALLLRLVRNNIKDVDQPIL
IFSSKEDHVVPPENQRWIYENVSSQTKELVTLENSYHVATMDYDLELIEQKSLEFIQKLL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggctttcttcaaagagggaaatgatgtaggtgttttggttatacacggcttt
acggggtcgccaggaagcatgcgcgacctggctcaattctatgccgatcaaggtttcact
gtcgctttgccaagacttgctggtcacggtacaactccagaagaccttgaaaagcgtaaa
tatcaagaatggatagaagacgtggaaaaagcatatgaatggctaaaagagcgcactagt
aaacgatttgtgacaggactttctatgggcggtacgttaacactctatatgggcgaaaag
cacaaagacattacggggcttataaccataaacgcagcagtacgaatgccaaatgagacc
tccatgctcatattagggtccttgggtataccaagatttgcaaagggcgtaggtagtgac
atcaagaaaggcatcaaagagccagcatatgagcttacaccgatacgagccacaaaacag
cttgctttactgctaagattggtcagaaacaatataaaagatgtcgatcaacccatactt
atcttctcttccaaggaagatcatgtggtaccaccagagaaccaaagatggatttacgaa
aacgtaagctcacagaccaaagaacttgtaacattggagaacagctaccatgtagctacc
atggattacgatttagagctcattgagcaaaaaagtctggagttcattcaaaagttgcta
tga

DBGET integrated database retrieval system