KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007653
Entry
CpipJ_CPIJ007653  CDS       T01079                                 

Definition
(GenBank) actin binding protein
  KO
K10456  kelch-like protein 19
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CpipJ_CPIJ007653
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cqu04121]
    CpipJ_CPIJ007653
Ubiquitin system [BR:cqu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     CpipJ_CPIJ007653
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BACK BTB Kelch_2 Kelch_3 Kelch_4 HU-CCDC81_euk_1
Other DBs
NCBI-ProteinID: EDS29766
VectorBase: CPIJ007653
UniProt: B0WKE7
AA seq 834 aa
METAADFIDHLSDADGIAFGDGIGSHGRSGGATGGGDEELGDMTFFMSNYAKEALKMMFM
MRSHHMLTDVTLEVEQETFQAHKVVLSAASPYFKAMFTGGLKECEMSRVKLQGVCPTAMA
RILFFMYTGHIRVTEVTVCQLLPAATMFQVPNVIEACCAFLERQLDPTNAIGIANFAEQH
GCETLKQKANQFIERNFTKICHEDEFLELSVIQLISLIRKDELNVQAERDVYDAVLKWVK
HDEDNRYPKMEHILYAVRCQLLTPSFLKEQMKTCNVLRRAPACREYLAKIFEDLTLHKRP
AVKERKPNTTRMIFVAGGYFRHSLDMLEGYNVDDKVWITLPKLTVPRSGLGAAFLKGTFY
AVGGRNNSPGSSYDSDWVDRYNPISETWGPCSPMSVPRNRVGVAVMDELLYAVGGSAGSE
YHNTVEYYDPELDRWTLVQPMHSKRLGVGVAVVNRLLYAIGGFDGRERLASVECYHPENN
EWTAVPSMQHGRSGAGVAALHQHIYVVGGFDGTRQLETVERYDTELQSWEMVAPVRIARS
ALSLTVLDGRLYAMGGYDGQNFLAIVEVYDPATNVWTEGTPLTSGRSGHASAVIYTPSCI
SSYMESLNISEDAKNGKKGERRTGGGSDDGPTNRQAMECVSSSSSNSRGAGPGGRSCADN
IPINVHDDSELMNALCTHVEGTCLKMPYVMTPPETVKEAPSSESDYAMETDSSLCEEESD
DPESAETIPLEGVPPPEVPPVNDCQQRSVPRKSKCLIKRKASAVWNDEHCPLVRLKRQIT
CFVSSIVSPPSSSSGCCNGSTAQAKEPTSDPSTDSSSNEATLRSQKDRTKDAFS
NT seq 2505 nt   +upstreamnt  +downstreamnt
atggagaccgcagcggatttcatcgaccacctgagcgacgcggatggcatagcgttcggg
gacggcatcggttcgcacggccggagcggcggcgcaaccggtggcggcgatgaagagctc
ggcgacatgaccttcttcatgtccaactatgcaaaggaggcactcaagatgatgttcatg
atgcggtcgcaccacatgctgacggacgtgacgctcgaggtggaacaggagacgttccag
gcgcacaaggttgtcctgtcggcggccagtccgtacttcaaggcgatgttcaccggtggg
ctgaaggagtgcgaaatgtcccgggtgaagctgcagggcgtgtgtccgacggcgatggcg
cgcatcctgttcttcatgtacaccggccacatccgggtgacggaggtgacggtgtgtcag
ctgctgccggcggccaccatgttccaggtgccgaacgtgatcgaggcgtgctgcgcgttc
ctggagcggcagctcgatccgacgaacgccatcgggattgcgaactttgccgagcagcac
ggctgcgaaacgctcaagcagaaggcgaaccagtttattgagcggaactttaccaaaatc
tgccacgaggatgaattcctggaactatctgtgattcagctaataagtttaattaggaaa
gacgaactgaacgtgcaggccgagcgggacgtgtacgacgcggtgctcaagtgggtcaaa
catgacgaggacaaccggtaccccaagatggagcacatcctgtacgccgtgcggtgtcaa
ctgctgacgccgagcttcctcaaggagcagatgaagacgtgcaacgtgctgcgaagggcg
cccgcctgtcgcgagtatctggccaagatcttcgaggacctgacgctgcacaagcgaccg
gccgtgaaggagcgcaaacccaacaccacgcggatgatcttcgtggccggcggctacttt
cgacattccctggacatgctcgaagggtacaacgtggacgacaaggtgtggatcacgctg
cccaagctgacggtgccccggtcggggctgggggcggccttcctcaaggggacgttttac
gcggtcggcggacggaacaattcgcccggctcgtcgtacgactccgactgggttgaccgg
tacaacccgatatcggagacgtggggaccgtgctcgcccatgtcggtgccgcggaatcgc
gtcggggtggccgtcatggatgagctgctgtacgcagttggagggtccgccggttcggag
taccacaataccgttgaatattatgaccccgaactggatcgctggacgctcgtccaaccg
atgcactcgaagcgactgggcgtgggcgttgccgtcgtgaaccgactgctgtacgccatc
ggtggcttcgacggccgggaacggctcgcttcggtcgagtgttaccacccggagaataac
gagtggacggcggtgccttcgatgcagcacggtcgatcgggggcgggcgttgccgcgctt
caccagcacatctacgtcgtgggcggtttcgacggaacgcgccagctggagacggttgag
cggtacgacacggagctgcaaagctgggaaatggttgcgccggtacggatagctcgaagt
gcgctctcgttgaccgtgctggacgggcggttgtacgcaatgggcgggtacgacgggcag
aactttttggcgattgtagaggtgtacgatccggcgacgaacgtgtggaccgagggaacg
ccgctgacctctgggaggagtgggcacgcctcggctgtgatatacacgccgtcctgcatc
tcaagctacatggaaagtctgaacattagcgaagacgccaagaacggaaagaagggtgaa
cggagaacgggaggaggttcggacgatggtccgacgaatcggcaagcgatggaatgcgtg
tcgtcttcatcgtcgaactcgcggggagccggccctggtggacggagttgcgccgacaac
atcccaatcaacgtgcacgacgactccgagctaatgaacgcgctgtgcactcatgtcgag
ggcacctgtctcaagatgccgtacgtgatgaccccgccggaaacggtcaaggaagcgccc
agcagcgagagtgactatgccatggaaaccgattctagtctgtgtgaggaagaaagtgac
gacccggagtcggcggagacgatcccactcgagggcgttccaccgccggaagtcccgccc
gtcaacgactgccagcaacgatcggtgcctcgcaagtccaagtgcttaatcaagcggaaa
gcgtccgccgtttggaacgacgagcactgcccgctggtgcgactgaagcgacaaatcacc
tgcttcgtgtcttcgattgtgtccccgccctcgtcctcgtctggttgttgtaacgggtca
acagcacaagcaaaggaaccgacgtcagatccctccactgactcatcctcaaacgaagcg
acgcttcgatcgcaaaaagaccgcacgaaggacgcgttctcctga

DBGET integrated database retrieval system