KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ011687
Entry
CpipJ_CPIJ011687  CDS       T01079                                 

Definition
(RefSeq) inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00230  Purine metabolism
cqu00983  Drug metabolism - other enzymes
cqu01100  Metabolic pathways
Module
cqu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CpipJ_CPIJ011687
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    CpipJ_CPIJ011687
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cqu04147]
    CpipJ_CPIJ011687
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     CpipJ_CPIJ011687
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CpipJ_CPIJ011687
  Exosomal proteins of breast cancer cells
   CpipJ_CPIJ011687
SSDB
Motif
Pfam: IMPDH CBS NMO FMN_dh NanE His_biosynth ThiG Aldolase Dus Glu_synthase G3P_antiterm YpsA DUF561 DHO_dh B12-binding
Other DBs
NCBI-GeneID: 6044097
NCBI-ProteinID: XP_001861658
VectorBase: CPIJ011687
UniProt: B0WW86
AA seq 512 aa
MAMKNGVNLQDGLSCEGLFQNSDGLTYNDFIILPGFIDFSADAVDLASPLTKKINLKAPL
VSSPMDTVTEADMAIAMALCGGIGIIHHNCTPEFQANEVHKVKKYKHGFIRDPIVMSPEN
TVADVLEAKRKNGFTGYPITEHGRLGERLIGIVTSRDIDFREEDVDLKLRDIMTKIEDMV
TAPSGVTLQEANHILEKSKKGKLPIVNKNGELVALIARTDLKKARSYPNASKDSNKQLLV
GAAISTREEDKERLELLVQNGVDVVVLDSSQGNSIYQMNMIKYIKQTYPELQVIAGNVVT
RQQAMNLIDAGCDALRVGMGSGSICITQEVMACGCPQATAVYQVSKLSREFGVPVIADGG
IQSIGHIMKAISLGASSVMMGSLLAGTSEAPGDYYFSDGVRLKKYRGMGSLEAMERKDAK
GAAGSRYYHTDIDKLRVAQGVSGSIVDKGSVLRFLPYLQCGLQHSCQDIGTKSLQNLKTM
IYNGELRFMRRTHSAQAEGNVHSLFSYEKRLY
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggccatgaagaacggagtcaacctccaggatgggctatcctgcgaggggttgtttcag
aacagtgacgggttgacctacaatgactttatcatccttcccggcttcatcgacttttcc
gcggatgccgtggatctggcttcgccgctgacgaagaagatcaacctgaaggccccgctg
gtttcgtccccgatggataccgtcacggaggcggacatggccattgcgatggcgctgtgc
ggcggcatcggtatcattcaccacaactgcacgcccgagttccaggcgaacgaggtgcac
aaggtgaagaagtacaagcatggtttcatccgcgacccgatcgtgatgagtccggagaac
acggtcgcggacgtgcttgaggccaagcggaagaacggtttcaccggctacccaatcacc
gagcacggccggctgggcgagcggttgattggcattgtgacctcgcgggacattgacttc
cgcgaggaggacgtcgatctgaagctgcgggacattatgacaaagattgaggacatggtg
acggccccgagtggggttacactgcaggaggcgaaccacatcttggagaagagcaagaag
ggaaaactgccgattgtgaacaagaatggagagctggtggcgcttattgcccggacggat
ttgaagaaagctagaagttacccgaacgcgtccaaggacagcaacaaacagctgttggtc
ggggctgccatttcgacccgggaggaagataaggaacggctcgagctgctcgttcagaac
ggcgttgacgtggtcgtgctggattcgtcgcagggcaattccatctaccagatgaacatg
atcaagtacatcaagcaaacttaccccgagctgcaggtcatcgccggcaacgtggtcacc
cgccagcaggcaatgaacctgatcgatgccggctgtgacgcgttgcgtgtgggcatgggt
tccggctcgatttgcatcacgcaggaggtgatggcgtgcggatgcccgcaagccacggcc
gtctaccaggtcagcaagctgtcccgcgagtttggagtcccggtcattgccgacggtggc
atccagtccatcgggcacattatgaaggccatctcgctgggtgcgtccagcgtgatgatg
ggatcgttgctggccggaacttcggaagctcccggcgattactacttcagcgatggcgta
cgcctcaagaagtatcgcggaatgggcagcctggaagcgatggaacgcaaggacgccaag
ggagcggccggatcgcggtactaccacaccgacattgacaagctgcgcgtggcccagggc
gtcagcggaagcatcgtcgacaagggttccgtgctacggttcctgccatatctgcagtgt
ggattgcagcacagctgccaggacatcggaaccaaatccctccagaatcttaaaacaatg
atctacaacggcgagctgcgcttcatgagacgcacccactcggcccaggccgaaggcaac
gtacacagcttgttctcgtacgagaagagattgtactaa

DBGET integrated database retrieval system