KEGG   Chlorocebus sabaeus (green monkey): 103220079
Entry
103220079         CDS       T04361                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csab03036]
    103220079 (ANKRD53)
Chromosome and associated proteins [BR:csab03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    103220079 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 103220079
NCBI-ProteinID: XP_007968484
Ensembl: ENSCSAG00000015223
Position
14
AA seq 596 aa
MASAGSTARRAGSGSWHSERGEGRGARPQPTPHGSMQRANKVSLKATWTDAESKQPRWVA
GEGVQAARRENPAQCLPGGQGLERAGAEAAAREARRARRGPRIASRGARAVAQSRFPTAP
PTSQPLPYLADHLRAQATALAWPRRPASLTAPHAHPSPSEESDQTTIDQTAIRSYYQLFA
AAVGNVEWLRFCLNQSLREIPTDYKGFTAIHFAAQRGKLACLQVLVEEYKFPVNLLTNNS
QTPLHLVIHKDNTTVALPCIYYLLEKGAALNAQTCNGSTPLHLAVREGLLDCVKVLVQSG
ANVHAQDAMGYKPIDFCKIWNHRACARFLKDAMWKKDKKDFAREMRKMKTLKSQLALMEY
NYLIEYQKEHKILREAAIRKWLHGKLHPGHSLVSNTKQARATALSKTPEQRGSQCSSSFH
PSVEARLQCIPQPTEMPKPIYRKSTIKRPTMWNVSNNPARPPTTKISHSQGIRLGVHPDP
SPDHDFSSFLEVRPDRHGGAWLHTVDGHWVAPVPRLPFEVLLRMLYPRVRPYRMKVPQGF
YPISMREVPRKRHLGDDTFWTDTLAMNLRDTFDEAFLAAVRSHQGLPALPSPQINP
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggcctccgcgggcagcaccgctcggcgggcgggctcgggaagctggcactcagaaagg
ggagaaggtagaggtgctcggccgcagccaactccacatggctccatgcagcgggcgaac
aaagtctccttgaaggccacctggactgatgcggagtccaagcagcccaggtgggtagcg
ggagaaggtgtccaggctgcgaggcgcgagaacccggcccagtgcctccctggtgggcag
ggcctggagcgggcgggggcggaggctgcggccagagaagcccggagagccaggcggggg
ccaaggatcgcctcccgaggtgcccgggccgtggcccagagtcgcttccccactgccccg
cccaccagccagcccctgccctacctcgccgaccacctccgtgcgcaggcgactgccctc
gcctggccacgccgccctgcctcgctcaccgcgccccacgctcatcccagccccagcgag
gagtccgaccagaccacgatcgaccagacggcgatccggagctactaccagctgttcgcg
gcggctgtgggcaacgtggaatggctgcggttctgtctgaaccagagcctcagggaaatc
cccaccgactacaagggcttcactgccatccacttcgcagcccaacggggcaagcttgca
tgcctgcaggtcctggtagaggaatacaagtttcccgtgaacctgctgaccaacaatagc
cagactcccctgcacctcgtcatccacaaggacaacaccaccgtggccctcccctgcatc
tactacctgctggagaaaggcgcagccctcaatgctcagacatgcaacggctccacgccc
ctgcacctggcagtccgtgagggcctgctggactgtgtgaaggtcctggtacagagtggc
gccaacgtccacgcccaagatgccatgggctacaaacccattgacttctgcaaaatatgg
aaccaccgtgcctgtgcccggttcttgaaggatgccatgtggaaaaaggacaagaaggac
tttgcccgtgagatgagaaaaatgaagacactcaagagccagctggccctcatggagtac
aactacctgattgagtatcaaaaagagcacaaaattctcagagaagctgctatcagaaag
tggctacacggcaagctgcacccaggccactctctggtctctaataccaagcaagcccgg
gccaccgccctctccaagaccccagagcaacgaggatcgcagtgttccagcagcttccac
ccctctgtggaggcgcgcctgcaatgcattccacagcccacggagatgcccaagcccatc
tacaggaagtccacgatcaagcggcccacgatgtggaatgttagcaacaaccctgccaga
ccccccaccaccaagatcagccactcgcaaggcatccgcctgggcgtgcatccagacccc
agcccggaccacgacttcagcagcttcctggaggtgaggccagaccggcacggcggtgcg
tggctgcacacagtggacggccactgggtggcgccagtgccgcggctgccttttgaggtg
ctgctccgcatgctgtacccacgtgtgcggccgtacagaatgaaggtgccccagggcttt
taccccatcagcatgagggaagtgcccaggaagcggcacctgggtgacgacaccttctgg
accgacactctggccatgaacctgcgtgacacatttgatgaagccttcctggcagctgtg
cgatcccatcaaggactccctgccctgccctccccacaaatcaacccataa

DBGET integrated database retrieval system