KEGG   Chlorocebus sabaeus (green monkey): 103226444
Entry
103226444         CDS       T04361                                 

Gene name
ANKMY2
Definition
(RefSeq) ankyrin repeat and MYND domain containing 2
Organism
csab  Chlorocebus sabaeus (green monkey)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3 zf-MYND PolC_DP2
Other DBs
NCBI-GeneID: 103226444
NCBI-ProteinID: XP_007980170
Ensembl: ENSCSAG00000013466
UniProt: A0A0D9RLZ0
Position
21
AA seq 441 aa
MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLD
MCKLLLRHGADVNCHQHEHGYTALMFAALSGNKDITWVMLEAGAETDVVNSVGRTAAQMA
AFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKLPPKLAGPLHKIITTTNLHPVKIVM
LVNENPLLTEEAALNKCYRVMDLICEKCMKQRDMNEVLAMKMHYISCIFQKCINFLKDGE
NKLDTLIKSLLKGRASDGFPVCQEKIIRESIRKFPYCEATLLQQLVRSIAPVEIGSDPTA
FSVLTQAITGQVGFVDVEFCTTCGEKGASKRCSVCKMVIYCDQTCQKTHWFTHKKICKNL
KDIYEKQQLEAAKEKRQEENYGKLDVNSNCVNEEQPEAEVGISQKDSNPEDSREGKKESL
ESEAELEGLQDAPAGPQVSEE
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggttcacataaagaaaggcgagctgacccaggaggagaaggagctgctggaagtcatc
gggaaaggtactgtccaagaagctggaacattattatccagcaagaatgttcgtgtcaac
tgtttggatgagaatggaatgactcctctaatgcatgcagcatataaaggaaaactcgat
atgtgcaaattactactgcgacatggagccgatgtaaattgccatcagcatgaacatgga
tacacagccctcatgtttgctgcactttctggtaataaagacatcacgtgggtaatgttg
gaagctggtgctgagacagatgttgtcaactctgtgggaagaacagcagctcagatggca
gcctttgtgggtcaacatgattgtgtgaccataatcaacaatttctttcctcgagagaga
ctggattattacactaagccccagggactggataaagagccaaaactgcccccaaagttg
gcaggcccgctgcacaaaatcatcaccacaacgaatcttcatcctgtcaagatcgtgatg
cttgtaaatgagaatcctctgctgacagaagaagcagccctgaataaatgctacagagtg
atggatttgatttgtgagaaatgtatgaagcaaagagacatgaatgaagtattggctatg
aaaatgcattacataagctgtatctttcagaaatgcattaacttcttgaaagatggagag
aataaactggacaccttgatcaaaagcttgttaaaaggccgagcttctgatggctttcca
gtgtgtcaagaaaagatcattagagaaagtatcagaaaatttccttactgtgaagctaca
ctcctccagcagctggttcgaagcattgctcctgttgaaattggttctgatcccactgct
ttctccgtccttacccaagccatcactggccaggtgggttttgtggatgtggaattttgc
actacctgtggagaaaagggagcaagtaaaagatgttcagtttgcaaaatggtgatatat
tgtgatcaaacctgccagaaaacacactggtttactcataagaaaatctgtaagaatctg
aaggacatttacgaaaagcaacaattggaggctgccaaagaaaagagacaagaggaaaac
tacggcaaacttgatgtcaattctaactgtgttaatgaagagcaaccagaggctgaagtg
ggtatctcccaaaaagattccaatcctgaagattccagggaaggaaagaaagaatctctt
gaaagtgaagctgagttggaaggcttacaggatgctcctgcagggccacaggtgtcggag
gagtaa

DBGET integrated database retrieval system